Skip to content

Instantly share code, notes, and snippets.

@meren
Created August 11, 2020 17:27
Show Gist options
  • Select an option

  • Save meren/bb27156e827551c1994181036173b200 to your computer and use it in GitHub Desktop.

Select an option

Save meren/bb27156e827551c1994181036173b200 to your computer and use it in GitHub Desktop.
Get gene calls and their sequences from an anvi'o contigs database
from anvio.dbops import ContigsSuperclass
# if your args object contains a `contigs_db` entry in its
# namespace all you don't need the following two lines and
# you can directly pass it to the ContigsSuperclass.
import argparse
args = argparse.Namespace(contigs_db="INFANT-GUT-TUTORIAL/SPLITAH/E_facealis/CONTIGS.db")
# get an instance of the contigs super:
contigs_db = ContigsSuperclass(args)
# learn every gene caller in the database:
gene_caller_ids = list(contigs_db.genes_in_contigs_dict.keys())
# and you're done:
gene_caller_ids, gene_sequences_dict = contigs_db.get_sequences_for_gene_callers_ids(gene_caller_ids, include_aa_sequences=True)
# how many genes?
print(f"num genes:\n{len(gene_caller_ids)}\n\n")
# first few gene caller ids:
print(f"first few gene caller ids:\n{gene_caller_ids[0:20]}\n\n")
# just to see the output data structure, lets
# print out the very first entry in gene sequences
# dict :)
print(f"example data for gene caller id 17:\n")
import anvio
anvio.P(gene_sequences_dict[4])
$ python get_genes.py
num genes:
2754
first few gene caller ids:
[0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19]
example data for gene caller id 17:
{
"sequence": "ATGAAACATTCACAACTTGTGGCGATTATTAAGAGACTGGAAGCAATGATCGAAGCAGCAGATAATGAAGTACAAGTACGCCGCTTTGAACGTGAAGGCGTAGAGAAATGTATTGTAAGTTTTGATAAATCAACAGAAACATTTGAATTAACAGAATCTGATACGCACCAAAGCTATCAATTCGATAACATCGATATTGTAGCAATGGAAATTTACGACTTAATTCAATAA",
"contig": "Day17a_QCcontig1",
"start": 3552,
"stop": 3783,
"direction": "f",
"rev_compd": "False",
"length": 231,
"aa_sequence": "MKHSQLVAIIKRLEAMIEAADNEVQVRRFEREGVEKCIVSFDKSTETFELTESDTHQSYQFDNIDIVAMEIYDLIQ"
}
Sign up for free to join this conversation on GitHub. Already have an account? Sign in to comment