Created
November 30, 2022 07:03
-
-
Save MonoidMusician/0d7548c6bd6a606110b3c4c7d9c765f8 to your computer and use it in GitHub Desktop.
times in milliseconds, negative numbers for package versions that failed to solve
This file contains hidden or bidirectional Unicode text that may be interpreted or compiled differently than what appears below. To review, open the file in an editor that reveals hidden Unicode characters.
Learn more about bidirectional Unicode characters
| { | |
| "abc-parser@1.1.2": | |
| 300, | |
| "abc-parser@1.2.0": | |
| 537, | |
| "abc-parser@1.2.1": | |
| 513, | |
| "abc-parser@1.3.0": | |
| 398, | |
| "abc-parser@1.4.0": | |
| 536, | |
| "abc-parser@1.5.0": | |
| 391, | |
| "abc-parser@1.6.0": | |
| 383, | |
| "abc-parser@1.6.1": | |
| 384, | |
| "abc-parser@1.6.2": | |
| 389, | |
| "abc-parser@1.7.0": | |
| 384, | |
| "abc-parser@1.8.0": | |
| 328, | |
| "abc-parser@1.9.0": | |
| 422, | |
| "abc-parser@1.9.1": | |
| 319, | |
| "abc-parser@1.9.2": | |
| 316, | |
| "abc-parser@1.9.3": | |
| 320, | |
| "abc-parser@2.0.0": | |
| 115, | |
| "abides@0.0.0": | |
| 172, | |
| "abides@0.0.1": | |
| 93, | |
| "abstract-database@0.0.1": | |
| 171, | |
| "abstract-database@0.0.2": | |
| 167, | |
| "abstract-database@0.0.3": | |
| 166, | |
| "abstract-database@0.0.4": | |
| 164, | |
| "abstract-database@0.0.5": | |
| 166, | |
| "abstract-database@0.0.6": | |
| 167, | |
| "abstract-database@0.0.8": | |
| 302, | |
| "abstract-database@0.0.9": | |
| 160, | |
| "abstract-database@0.0.10": | |
| 167, | |
| "abstract-database@0.0.11": | |
| 168, | |
| "abstract-database@0.0.12": | |
| 169, | |
| "abstract-database@0.0.13": | |
| 232, | |
| "abstract-database@0.0.14": | |
| -246, | |
| "abstract-database@0.0.15": | |
| -336, | |
| "abstract-database@0.0.16": | |
| -237, | |
| "abstract-database@0.0.17": | |
| -239, | |
| "abstract-database@0.0.18": | |
| -238, | |
| "abstract-database@0.0.19": | |
| -239, | |
| "abstract-database@0.0.20": | |
| -242, | |
| "accounting@0.1.0": | |
| 59, | |
| "accounting@0.2.0": | |
| 73, | |
| "accounting@0.4.0": | |
| 121, | |
| "ace@0.1.0": | |
| 79, | |
| "ace@0.2.0": | |
| 98, | |
| "ace@0.3.0": | |
| 126, | |
| "ace@0.4.0": | |
| 120, | |
| "ace@0.8.0": | |
| 112, | |
| "ace@0.8.1": | |
| 114, | |
| "ace@0.9.0": | |
| 179, | |
| "ace@0.10.0": | |
| 92, | |
| "ace@0.10.1": | |
| 99, | |
| "ace@0.11.0": | |
| 97, | |
| "ace@0.11.1": | |
| 97, | |
| "ace@1.0.0": | |
| 185, | |
| "ace@2.0.0": | |
| -208, | |
| "ace@3.0.0": | |
| 411, | |
| "ace@4.0.0": | |
| 518, | |
| "ace@5.0.0": | |
| 194, | |
| "ace@6.0.0": | |
| 192, | |
| "ace@7.0.0": | |
| 200, | |
| "ace@7.1.0": | |
| 300, | |
| "ace@8.0.0": | |
| 141, | |
| "ace@9.0.0": | |
| 115, | |
| "ace-halogen@0.1.0": | |
| 235, | |
| "ace-halogen@0.2.0": | |
| 229, | |
| "ace-halogen@0.3.0": | |
| 199, | |
| "ace-halogen@0.4.0": | |
| 206, | |
| "ace-halogen@0.5.0": | |
| 199, | |
| "ace-halogen@0.6.0": | |
| 329, | |
| "ace-halogen@0.7.0": | |
| 125, | |
| "ace-halogen@0.8.0": | |
| 136, | |
| "ace-halogen@0.8.1": | |
| 136, | |
| "ace-halogen@0.9.0": | |
| 134, | |
| "ace-halogen@1.0.0": | |
| 104, | |
| "ace-halogen@2.0.0": | |
| 102, | |
| "ace-halogen@3.0.0": | |
| -367, | |
| "ace-halogen@4.0.0": | |
| -475, | |
| "ace-halogen@5.0.0": | |
| -518, | |
| "ace-halogen@6.0.0": | |
| 1223, | |
| "ace-halogen@7.0.0": | |
| 883, | |
| "ace-halogen-012@0.1.0": | |
| 230, | |
| "ace-halogen-012@0.2.0": | |
| 308, | |
| "ace-halogen-012@0.3.0": | |
| 190, | |
| "ace-halogen-012@0.4.0": | |
| 197, | |
| "ace-halogen-012@0.5.0": | |
| 200, | |
| "ace-halogen-012@0.6.0": | |
| 200, | |
| "ace-halogen-012@0.7.0": | |
| 137, | |
| "ace-halogen-012@0.8.0": | |
| 135, | |
| "ace-halogen-012@0.8.1": | |
| 135, | |
| "ace-halogen-012@0.9.0": | |
| 257, | |
| "ace-halogen-012@1.0.0": | |
| 91, | |
| "ace-halogen-012@2.0.0": | |
| 109, | |
| "ace-halogen-012@3.0.0": | |
| -232, | |
| "ace-halogen-012@4.0.0": | |
| -506, | |
| "ace-halogen-012@5.0.0": | |
| -525, | |
| "ace-halogen-012@6.0.0": | |
| 1243, | |
| "ace-halogen-012@7.0.0": | |
| 997, | |
| "activity-monitor@0.1.0": | |
| 242, | |
| "activity-monitor@0.1.1": | |
| 249, | |
| "activity-monitor@0.1.2": | |
| 252, | |
| "aff@0.1.0": | |
| 78, | |
| "aff@0.2.0": | |
| 77, | |
| "aff@0.2.1": | |
| 145, | |
| "aff@0.3.0": | |
| 81, | |
| "aff@0.4.0": | |
| 85, | |
| "aff@0.5.0": | |
| 82, | |
| "aff@0.5.1": | |
| 82, | |
| "aff@0.5.2": | |
| 80, | |
| "aff@0.5.3": | |
| 160, | |
| "aff@0.5.4": | |
| 80, | |
| "aff@0.5.5": | |
| 81, | |
| "aff@0.5.6": | |
| 90, | |
| "aff@0.6.0": | |
| 83, | |
| "aff@0.7.0": | |
| 83, | |
| "aff@0.8.0": | |
| 174, | |
| "aff@0.9.0": | |
| 83, | |
| "aff@0.9.1": | |
| 77, | |
| "aff@0.9.2": | |
| 86, | |
| "aff@0.10.0": | |
| 80, | |
| "aff@0.10.1": | |
| 82, | |
| "aff@0.11.0": | |
| 89, | |
| "aff@0.11.1": | |
| 93, | |
| "aff@0.11.2": | |
| 197, | |
| "aff@0.11.3": | |
| 79, | |
| "aff@0.12.0": | |
| 83, | |
| "aff@0.13.0": | |
| 80, | |
| "aff@0.13.1": | |
| 81, | |
| "aff@0.14.0": | |
| 81, | |
| "aff@0.14.1": | |
| 85, | |
| "aff@0.14.2": | |
| 189, | |
| "aff@0.15.0": | |
| 97, | |
| "aff@0.16.0": | |
| 78, | |
| "aff@0.16.1": | |
| 82, | |
| "aff@0.16.2": | |
| 82, | |
| "aff@0.17.0": | |
| 74, | |
| "aff@1.0.0": | |
| 71, | |
| "aff@1.1.0": | |
| 74, | |
| "aff@2.0.0": | |
| 266, | |
| "aff@2.0.1": | |
| 132, | |
| "aff@2.0.2": | |
| -108, | |
| "aff@2.0.3": | |
| 134, | |
| "aff@3.0.0": | |
| 248, | |
| "aff@3.1.0": | |
| 312, | |
| "aff@4.0.0": | |
| 336, | |
| "aff@4.0.1": | |
| 337, | |
| "aff@4.0.2": | |
| 429, | |
| "aff@4.1.0": | |
| 326, | |
| "aff@4.1.1": | |
| 340, | |
| "aff@5.0.0": | |
| 156, | |
| "aff@5.0.1": | |
| 240, | |
| "aff@5.0.2": | |
| 151, | |
| "aff@5.1.0": | |
| 150, | |
| "aff@5.1.1": | |
| 157, | |
| "aff@5.1.2": | |
| 159, | |
| "aff@6.0.0": | |
| 101, | |
| "aff@7.0.0": | |
| 87, | |
| "aff@7.1.0": | |
| 90, | |
| "aff-bus@1.0.0": | |
| 361, | |
| "aff-bus@2.0.0": | |
| 412, | |
| "aff-bus@3.0.0": | |
| 450, | |
| "aff-bus@3.0.1": | |
| 448, | |
| "aff-bus@3.1.0": | |
| 442, | |
| "aff-bus@4.0.0": | |
| 259, | |
| "aff-bus@5.0.0": | |
| 125, | |
| "aff-bus@5.0.1": | |
| 127, | |
| "aff-bus@6.0.0": | |
| 194, | |
| "aff-cache@0.1.0": | |
| 389, | |
| "aff-coroutines@0.1.0": | |
| 82, | |
| "aff-coroutines@0.1.1": | |
| 87, | |
| "aff-coroutines@0.2.0": | |
| 87, | |
| "aff-coroutines@0.2.1": | |
| 84, | |
| "aff-coroutines@0.3.0": | |
| 177, | |
| "aff-coroutines@0.4.0": | |
| 92, | |
| "aff-coroutines@0.4.1": | |
| 91, | |
| "aff-coroutines@0.4.2": | |
| 90, | |
| "aff-coroutines@0.5.0": | |
| 94, | |
| "aff-coroutines@0.6.0": | |
| 91, | |
| "aff-coroutines@0.6.1": | |
| 91, | |
| "aff-coroutines@1.0.0": | |
| 73, | |
| "aff-coroutines@2.0.0": | |
| 153, | |
| "aff-coroutines@3.0.0": | |
| 84, | |
| "aff-coroutines@4.0.0": | |
| 185, | |
| "aff-coroutines@5.0.0": | |
| 282, | |
| "aff-coroutines@6.0.0": | |
| 310, | |
| "aff-coroutines@7.0.0": | |
| 298, | |
| "aff-coroutines@8.0.0": | |
| 248, | |
| "aff-coroutines@9.0.0": | |
| 109, | |
| "aff-free@0.1.0": | |
| 99, | |
| "aff-free@0.1.1": | |
| 100, | |
| "aff-free@0.1.2": | |
| 98, | |
| "aff-free@1.0.0": | |
| 80, | |
| "aff-free@2.0.0": | |
| 356, | |
| "aff-free@3.0.0": | |
| 350, | |
| "aff-future@1.0.0": | |
| 369, | |
| "aff-future@2.0.0": | |
| 290, | |
| "aff-parallel@0.1.0": | |
| 169, | |
| "aff-parallel@0.1.1": | |
| 170, | |
| "aff-promise@0.2.1": | |
| 72, | |
| "aff-promise@0.3.0": | |
| 195, | |
| "aff-promise@0.4.0": | |
| 283, | |
| "aff-promise@0.5.0": | |
| 387, | |
| "aff-promise@0.6.0": | |
| 445, | |
| "aff-promise@0.7.0": | |
| 443, | |
| "aff-promise@1.0.0": | |
| 457, | |
| "aff-promise@2.0.0": | |
| 273, | |
| "aff-promise@2.0.1": | |
| 278, | |
| "aff-promise@2.1.0": | |
| 280, | |
| "aff-promise@3.0.0": | |
| 221, | |
| "aff-promise@4.0.0": | |
| 98, | |
| "aff-reattempt@0.1.0": | |
| 95, | |
| "aff-reattempt@0.2.0": | |
| 92, | |
| "aff-reattempt@0.2.1": | |
| 90, | |
| "aff-reattempt@0.3.0": | |
| 89, | |
| "aff-reattempt@1.0.0": | |
| 72, | |
| "aff-reattempt@2.0.0": | |
| 182, | |
| "aff-reattempt@3.0.0": | |
| 660, | |
| "aff-reattempt@4.0.0": | |
| 434, | |
| "aff-reattempt@5.0.0": | |
| 276, | |
| "aff-retry@1.0.0": | |
| 349, | |
| "aff-retry@1.0.1": | |
| 351, | |
| "aff-retry@1.1.0": | |
| 352, | |
| "aff-retry@1.2.0": | |
| 211, | |
| "aff-retry@1.2.1": | |
| 427, | |
| "aff-retry@2.0.0": | |
| 90, | |
| "aff-throttler@0.0.1": | |
| 295, | |
| "aff-throttler@0.0.2": | |
| 297, | |
| "affjax@0.1.0": | |
| -77, | |
| "affjax@0.2.0": | |
| -84, | |
| "affjax@0.2.1": | |
| -77, | |
| "affjax@0.3.0": | |
| -84, | |
| "affjax@0.3.1": | |
| -170, | |
| "affjax@0.3.2": | |
| -83, | |
| "affjax@0.4.0": | |
| 108, | |
| "affjax@0.5.0": | |
| 100, | |
| "affjax@0.5.1": | |
| 101, | |
| "affjax@0.5.2": | |
| 106, | |
| "affjax@0.5.3": | |
| 114, | |
| "affjax@0.5.4": | |
| 104, | |
| "affjax@0.6.0": | |
| 240, | |
| "affjax@0.7.0": | |
| 93, | |
| "affjax@0.8.0": | |
| 117, | |
| "affjax@0.8.1": | |
| 113, | |
| "affjax@0.9.0": | |
| 109, | |
| "affjax@0.10.0": | |
| 125, | |
| "affjax@0.10.1": | |
| 126, | |
| "affjax@0.10.2": | |
| 127, | |
| "affjax@0.10.3": | |
| 209, | |
| "affjax@0.10.4": | |
| 123, | |
| "affjax@0.11.0": | |
| 127, | |
| "affjax@0.12.0": | |
| 124, | |
| "affjax@0.13.0": | |
| 121, | |
| "affjax@0.13.1": | |
| 211, | |
| "affjax@0.13.2": | |
| 97, | |
| "affjax@1.0.0": | |
| 76, | |
| "affjax@1.1.0": | |
| 82, | |
| "affjax@1.2.0": | |
| 86, | |
| "affjax@2.0.0": | |
| -202, | |
| "affjax@2.0.1": | |
| -197, | |
| "affjax@3.0.0": | |
| -358, | |
| "affjax@3.0.1": | |
| -482, | |
| "affjax@3.0.2": | |
| -362, | |
| "affjax@4.0.0": | |
| 456, | |
| "affjax@5.0.0": | |
| 465, | |
| "affjax@6.0.0": | |
| 324, | |
| "affjax@6.0.1": | |
| 321, | |
| "affjax@7.0.0": | |
| 340, | |
| "affjax@7.0.1": | |
| 441, | |
| "affjax@7.0.2": | |
| 330, | |
| "affjax@8.0.0": | |
| 333, | |
| "affjax@9.0.0": | |
| 325, | |
| "affjax@9.0.1": | |
| 322, | |
| "affjax@10.0.0": | |
| 323, | |
| "affjax@10.1.0": | |
| 328, | |
| "affjax@11.0.0": | |
| 408, | |
| "affjax@12.0.0": | |
| 130, | |
| "affjax@13.0.0": | |
| 120, | |
| "affjax-algebra@0.1.0": | |
| 134, | |
| "affjax-algebra@1.0.0": | |
| 101, | |
| "affjax-algebra@2.0.0": | |
| -410, | |
| "affjax-algebra@3.0.0": | |
| -601, | |
| "affjax-algebra@4.0.0": | |
| 906, | |
| "affjax-algebra@5.0.0": | |
| 833, | |
| "affjax-node@1.0.0": | |
| 140, | |
| "affjax-web@1.0.0": | |
| 141, | |
| "airconsole@0.1.0": | |
| 144, | |
| "airconsole@0.1.1": | |
| 76, | |
| "airconsole@0.2.0": | |
| 63, | |
| "airconsole@0.3.0": | |
| 402, | |
| "airconsole@0.3.1": | |
| 378, | |
| "airconsole-controls@0.1.0": | |
| 453, | |
| "airconsole-controls@0.1.1": | |
| 492, | |
| "airconsole-controls@0.1.2": | |
| 598, | |
| "airconsole-view-manager@0.1.0": | |
| 56, | |
| "airconsole-view-manager@0.1.1": | |
| 73, | |
| "airconsole-view-manager@0.1.2": | |
| 529, | |
| "airconsole-view-manager@0.1.3": | |
| 517, | |
| "alert@0.0.1": | |
| 57, | |
| "alert@0.0.2": | |
| 77, | |
| "alert@0.0.3": | |
| 61, | |
| "alexa@0.0.1": | |
| 534, | |
| "alexa@0.0.2": | |
| 355, | |
| "alexa@0.0.3": | |
| 363, | |
| "alexa@0.0.4": | |
| 366, | |
| "alexa@0.0.5": | |
| 368, | |
| "alexa@0.0.6": | |
| 370, | |
| "alexa@0.1.0": | |
| 453, | |
| "alexa@0.1.1": | |
| 568, | |
| "alexa@0.1.2": | |
| 433, | |
| "alexa@0.1.3": | |
| 443, | |
| "alexa@0.1.4": | |
| 448, | |
| "alexa@0.2.0": | |
| 453, | |
| "alexa@0.3.0": | |
| 450, | |
| "alexa@0.4.0": | |
| 219, | |
| "alexa@0.4.1": | |
| 297, | |
| "alexa@0.4.3": | |
| 236, | |
| "almost@0.0.1": | |
| 47, | |
| "almost@0.0.2": | |
| 74, | |
| "alphasucc@0.1.0": | |
| 60, | |
| "amazons@1.0.0": | |
| 186, | |
| "amazons@1.0.1": | |
| 175, | |
| "amqp@1.0.0": | |
| 585, | |
| "angle@0.1.0": | |
| 122, | |
| "annoy@0.0.1": | |
| 377, | |
| "annoy@0.1.0": | |
| 328, | |
| "annoy@0.1.1": | |
| 321, | |
| "ansi@0.1.3": | |
| 67, | |
| "ansi@1.0.0": | |
| 69, | |
| "ansi@2.0.0": | |
| 81, | |
| "ansi@3.0.0": | |
| 440, | |
| "ansi@4.0.0": | |
| 318, | |
| "ansi@5.0.0": | |
| 120, | |
| "ansi@6.0.0": | |
| 94, | |
| "ansi@6.1.0": | |
| 94, | |
| "ansi@7.0.0": | |
| 87, | |
| "apexcharts@0.4.1": | |
| 184, | |
| "api-helpers@0.1.0": | |
| 99, | |
| "api-helpers@0.11.0": | |
| 715, | |
| "api-helpers@1.0.0": | |
| 73, | |
| "api-helpers@1.1.0": | |
| -398, | |
| "api-helpers@1.2.0": | |
| -398, | |
| "api-helpers@1.2.1": | |
| -395, | |
| "api-helpers@1.2.2": | |
| -400, | |
| "api-helpers@1.2.3": | |
| -398, | |
| "applicative-lists@0.1.0": | |
| 157, | |
| "apply-algebra@0.1.0": | |
| 45, | |
| "apply-algebra@0.2.0": | |
| 80, | |
| "argonaut@0.0.6": | |
| -91, | |
| "argonaut@0.1.0": | |
| -83, | |
| "argonaut@0.1.1": | |
| -90, | |
| "argonaut@0.1.2": | |
| -85, | |
| "argonaut@0.2.0": | |
| -143, | |
| "argonaut@0.2.1": | |
| -79, | |
| "argonaut@0.2.2": | |
| -86, | |
| "argonaut@0.2.3": | |
| -81, | |
| "argonaut@0.2.4": | |
| -80, | |
| "argonaut@0.2.5": | |
| -165, | |
| "argonaut@0.2.6": | |
| -78, | |
| "argonaut@0.2.7": | |
| -67, | |
| "argonaut@0.2.8": | |
| -81, | |
| "argonaut@0.2.9": | |
| -85, | |
| "argonaut@0.2.10": | |
| -80, | |
| "argonaut@0.2.11": | |
| -85, | |
| "argonaut@0.3.0": | |
| -81, | |
| "argonaut@0.4.0": | |
| 188, | |
| "argonaut@0.5.0": | |
| 86, | |
| "argonaut@0.6.0": | |
| 91, | |
| "argonaut@0.8.0": | |
| -92, | |
| "argonaut@0.9.0": | |
| -125, | |
| "argonaut@0.10.0": | |
| 156, | |
| "argonaut@0.11.0": | |
| 168, | |
| "argonaut@0.12.0": | |
| 158, | |
| "argonaut@1.0.0": | |
| 167, | |
| "argonaut@2.0.0": | |
| 422, | |
| "argonaut@3.0.0": | |
| 543, | |
| "argonaut@3.1.0": | |
| 833, | |
| "argonaut@4.0.0": | |
| 317, | |
| "argonaut@4.0.1": | |
| 317, | |
| "argonaut@5.0.0": | |
| 366, | |
| "argonaut@6.0.0": | |
| 552, | |
| "argonaut@7.0.0": | |
| 340, | |
| "argonaut@8.0.0": | |
| 129, | |
| "argonaut@9.0.0": | |
| 119, | |
| "argonaut-aeson-generic@0.1.0": | |
| 723, | |
| "argonaut-aeson-generic@0.2.0": | |
| 408, | |
| "argonaut-aeson-generic@0.3.0": | |
| 413, | |
| "argonaut-codecs@0.1.0": | |
| 84, | |
| "argonaut-codecs@0.2.0": | |
| 179, | |
| "argonaut-codecs@0.3.0": | |
| 88, | |
| "argonaut-codecs@0.4.0": | |
| 108, | |
| "argonaut-codecs@0.4.1": | |
| 101, | |
| "argonaut-codecs@0.5.0": | |
| 102, | |
| "argonaut-codecs@0.5.1": | |
| 205, | |
| "argonaut-codecs@0.5.2": | |
| 85, | |
| "argonaut-codecs@0.6.0": | |
| 103, | |
| "argonaut-codecs@0.6.1": | |
| 100, | |
| "argonaut-codecs@1.0.0": | |
| 79, | |
| "argonaut-codecs@1.1.0": | |
| 77, | |
| "argonaut-codecs@2.0.0": | |
| 238, | |
| "argonaut-codecs@2.1.0": | |
| 293, | |
| "argonaut-codecs@3.0.0": | |
| 239, | |
| "argonaut-codecs@3.0.1": | |
| 308, | |
| "argonaut-codecs@3.1.0": | |
| 310, | |
| "argonaut-codecs@3.2.0": | |
| 443, | |
| "argonaut-codecs@3.3.0": | |
| 311, | |
| "argonaut-codecs@4.0.0": | |
| 171, | |
| "argonaut-codecs@4.0.1": | |
| 168, | |
| "argonaut-codecs@4.0.2": | |
| 264, | |
| "argonaut-codecs@5.0.0": | |
| 142, | |
| "argonaut-codecs@5.1.0": | |
| 153, | |
| "argonaut-codecs@5.1.1": | |
| 163, | |
| "argonaut-codecs@5.1.2": | |
| 162, | |
| "argonaut-codecs@5.1.3": | |
| 194, | |
| "argonaut-codecs@6.0.0": | |
| 263, | |
| "argonaut-codecs@6.0.1": | |
| 173, | |
| "argonaut-codecs@6.0.2": | |
| 166, | |
| "argonaut-codecs@6.1.0": | |
| 181, | |
| "argonaut-codecs@7.0.0": | |
| 147, | |
| "argonaut-codecs@8.0.0": | |
| 111, | |
| "argonaut-codecs@8.1.0": | |
| 114, | |
| "argonaut-codecs@9.0.0": | |
| 103, | |
| "argonaut-codecs@9.1.0": | |
| 213, | |
| "argonaut-core@0.1.0": | |
| 66, | |
| "argonaut-core@0.2.0": | |
| 77, | |
| "argonaut-core@0.2.1": | |
| 91, | |
| "argonaut-core@0.2.2": | |
| 87, | |
| "argonaut-core@0.2.3": | |
| 87, | |
| "argonaut-core@1.0.0": | |
| 76, | |
| "argonaut-core@1.1.0": | |
| 79, | |
| "argonaut-core@2.0.0": | |
| 293, | |
| "argonaut-core@2.0.1": | |
| 155, | |
| "argonaut-core@3.0.0": | |
| 269, | |
| "argonaut-core@3.1.0": | |
| 205, | |
| "argonaut-core@3.1.1": | |
| 265, | |
| "argonaut-core@4.0.0": | |
| 140, | |
| "argonaut-core@4.0.1": | |
| 137, | |
| "argonaut-core@5.0.0": | |
| 224, | |
| "argonaut-core@5.0.1": | |
| 130, | |
| "argonaut-core@5.0.2": | |
| 142, | |
| "argonaut-core@5.1.0": | |
| 138, | |
| "argonaut-core@6.0.0": | |
| 104, | |
| "argonaut-core@7.0.0": | |
| 194, | |
| "argonaut-generic@1.0.0": | |
| 952, | |
| "argonaut-generic@1.1.0": | |
| 368, | |
| "argonaut-generic@1.2.0": | |
| 371, | |
| "argonaut-generic@2.0.0": | |
| 207, | |
| "argonaut-generic@2.1.0": | |
| 228, | |
| "argonaut-generic@3.0.0": | |
| 227, | |
| "argonaut-generic@4.0.0": | |
| 341, | |
| "argonaut-generic@5.0.0": | |
| 220, | |
| "argonaut-generic@6.0.0": | |
| 198, | |
| "argonaut-generic@7.0.0": | |
| 128, | |
| "argonaut-generic@7.0.1": | |
| 130, | |
| "argonaut-generic@8.0.0": | |
| 113, | |
| "argonaut-generic-codecs@1.0.0": | |
| 76, | |
| "argonaut-generic-codecs@2.0.0": | |
| 162, | |
| "argonaut-generic-codecs@3.0.0": | |
| 70, | |
| "argonaut-generic-codecs@3.0.1": | |
| 65, | |
| "argonaut-generic-codecs@4.0.0": | |
| 195, | |
| "argonaut-generic-codecs@5.0.0": | |
| 181, | |
| "argonaut-generic-codecs@5.1.0": | |
| 172, | |
| "argonaut-generic-codecs@5.2.0": | |
| 173, | |
| "argonaut-generic-codecs@6.0.0": | |
| 384, | |
| "argonaut-generic-codecs@6.0.1": | |
| 265, | |
| "argonaut-generic-codecs@6.0.2": | |
| 275, | |
| "argonaut-generic-codecs@6.0.3": | |
| 240, | |
| "argonaut-generic-codecs@6.0.4": | |
| 455, | |
| "argonaut-traversals@0.2.0": | |
| 103, | |
| "argonaut-traversals@0.3.0": | |
| 211, | |
| "argonaut-traversals@0.4.0": | |
| 122, | |
| "argonaut-traversals@0.5.0": | |
| 123, | |
| "argonaut-traversals@0.6.0": | |
| 134, | |
| "argonaut-traversals@0.7.0": | |
| 130, | |
| "argonaut-traversals@1.0.0": | |
| 86, | |
| "argonaut-traversals@2.0.0": | |
| 351, | |
| "argonaut-traversals@2.0.1": | |
| -420, | |
| "argonaut-traversals@3.0.0": | |
| 626, | |
| "argonaut-traversals@3.1.0": | |
| 447, | |
| "argonaut-traversals@4.0.0": | |
| 241, | |
| "argonaut-traversals@4.0.1": | |
| 239, | |
| "argonaut-traversals@4.1.0": | |
| 235, | |
| "argonaut-traversals@5.0.0": | |
| 257, | |
| "argonaut-traversals@6.0.0": | |
| 378, | |
| "argonaut-traversals@7.0.0": | |
| 284, | |
| "argonaut-traversals@8.0.0": | |
| 255, | |
| "argonaut-traversals@9.0.0": | |
| 108, | |
| "argonaut-traversals@10.0.0": | |
| 98, | |
| "argparse-basic@1.0.0": | |
| 116, | |
| "argparse-basic@2.0.0": | |
| 90, | |
| "array-builder@0.1.2": | |
| 84, | |
| "array-search@0.2.0": | |
| 271, | |
| "array-search@0.3.0": | |
| 58, | |
| "array-search@0.3.1": | |
| 75, | |
| "array-views@0.0.1": | |
| 101, | |
| "array-views@0.0.2": | |
| 102, | |
| "arraybuffer@2.0.0": | |
| 57, | |
| "arraybuffer@3.0.0": | |
| 82, | |
| "arraybuffer@4.0.0": | |
| 70, | |
| "arraybuffer@5.0.0": | |
| 142, | |
| "arraybuffer@5.0.1": | |
| 60, | |
| "arraybuffer@6.0.0": | |
| 87, | |
| "arraybuffer@7.0.0": | |
| 472, | |
| "arraybuffer@7.1.0": | |
| 2137, | |
| "arraybuffer@8.0.0": | |
| 675, | |
| "arraybuffer@8.0.2": | |
| 544, | |
| "arraybuffer@8.0.3": | |
| 196, | |
| "arraybuffer@9.0.0": | |
| 646, | |
| "arraybuffer@10.0.0": | |
| 196, | |
| "arraybuffer@10.0.1": | |
| 175, | |
| "arraybuffer@10.0.2": | |
| 177, | |
| "arraybuffer@11.0.0": | |
| -243, | |
| "arraybuffer@11.0.1": | |
| 196, | |
| "arraybuffer@11.0.2": | |
| 82, | |
| "arraybuffer@11.0.3": | |
| 95, | |
| "arraybuffer@12.0.0": | |
| 95, | |
| "arraybuffer@13.0.0": | |
| 91, | |
| "arraybuffer-builder@1.0.0": | |
| 270, | |
| "arraybuffer-builder@1.1.0": | |
| 360, | |
| "arraybuffer-builder@2.0.0": | |
| 95, | |
| "arraybuffer-builder@2.1.0": | |
| 95, | |
| "arraybuffer-builder@3.0.0": | |
| 97, | |
| "arraybuffer-builder@3.0.1": | |
| 92, | |
| "arraybuffer-class@0.0.0": | |
| 275, | |
| "arraybuffer-class@0.1.0": | |
| 236, | |
| "arraybuffer-class@0.2.0": | |
| 233, | |
| "arraybuffer-class@0.2.1": | |
| 374, | |
| "arraybuffer-class@0.2.2": | |
| 221, | |
| "arraybuffer-class@0.2.3": | |
| 230, | |
| "arraybuffer-class@0.2.4": | |
| -424, | |
| "arraybuffer-class@0.2.5": | |
| -420, | |
| "arraybuffer-class@0.2.6": | |
| -428, | |
| "arraybuffer-types@0.2.0": | |
| 56, | |
| "arraybuffer-types@1.0.0": | |
| 141, | |
| "arraybuffer-types@2.0.0": | |
| 59, | |
| "arraybuffer-types@3.0.0": | |
| 62, | |
| "arraybuffer-types@3.0.1": | |
| 67, | |
| "arraybuffer-types@3.0.2": | |
| 65, | |
| "arrays@0.2.0": | |
| 68, | |
| "arrays@0.2.1": | |
| 69, | |
| "arrays@0.3.0": | |
| 69, | |
| "arrays@0.3.1": | |
| 93, | |
| "arrays@0.3.2": | |
| 112, | |
| "arrays@0.3.3": | |
| 44, | |
| "arrays@0.3.4": | |
| 72, | |
| "arrays@0.3.5": | |
| 67, | |
| "arrays@0.3.6": | |
| 69, | |
| "arrays@0.3.7": | |
| 69, | |
| "arrays@0.4.0": | |
| 83, | |
| "arrays@0.4.1": | |
| 90, | |
| "arrays@0.4.2": | |
| 137, | |
| "arrays@0.4.3": | |
| 74, | |
| "arrays@0.4.4": | |
| 79, | |
| "arrays@0.4.5": | |
| 73, | |
| "arrays@1.0.0": | |
| 67, | |
| "arrays@1.1.0": | |
| 73, | |
| "arrays@2.0.0": | |
| 90, | |
| "arrays@3.0.0": | |
| 161, | |
| "arrays@3.0.1": | |
| 66, | |
| "arrays@3.1.0": | |
| 84, | |
| "arrays@3.2.0": | |
| 81, | |
| "arrays@3.2.1": | |
| 84, | |
| "arrays@4.0.0": | |
| 100, | |
| "arrays@4.0.1": | |
| 95, | |
| "arrays@4.1.0": | |
| 174, | |
| "arrays@4.1.1": | |
| 89, | |
| "arrays@4.1.2": | |
| 102, | |
| "arrays@4.2.0": | |
| 99, | |
| "arrays@4.2.1": | |
| 96, | |
| "arrays@4.2.2": | |
| 94, | |
| "arrays@4.3.0": | |
| 182, | |
| "arrays@4.4.0": | |
| 88, | |
| "arrays@5.0.0": | |
| 71, | |
| "arrays@5.1.0": | |
| 89, | |
| "arrays@5.1.1": | |
| 79, | |
| "arrays@5.2.0": | |
| 84, | |
| "arrays@5.2.1": | |
| 84, | |
| "arrays@5.3.0": | |
| 84, | |
| "arrays@5.3.1": | |
| 162, | |
| "arrays@6.0.0": | |
| 76, | |
| "arrays@6.0.1": | |
| 68, | |
| "arrays@7.0.0": | |
| 81, | |
| "arrays@7.1.0": | |
| 80, | |
| "arrays-zipper@1.0.0": | |
| 86, | |
| "arrays-zipper@1.0.1": | |
| 340, | |
| "arrays-zipper@1.1.0": | |
| 327, | |
| "arrays-zipper@1.1.1": | |
| 264, | |
| "arrays-zipper@2.0.0": | |
| 3945, | |
| "arrays-zipper@2.0.1": | |
| 97, | |
| "arrows@0.2.0": | |
| 68, | |
| "arrows@0.3.0": | |
| 74, | |
| "arrows@0.4.0": | |
| 74, | |
| "arrows@0.5.0": | |
| 78, | |
| "arrows@0.6.0": | |
| 127, | |
| "arrows@0.6.1": | |
| 73, | |
| "arrows@0.6.2": | |
| 50, | |
| "ask@1.0.0": | |
| 69, | |
| "aspen@0.0.1": | |
| 86, | |
| "assert@0.1.0": | |
| 64, | |
| "assert@0.1.1": | |
| 67, | |
| "assert@1.0.0": | |
| 71, | |
| "assert@2.0.0": | |
| 72, | |
| "assert@3.0.0": | |
| 133, | |
| "assert@3.1.0": | |
| 50, | |
| "assert@4.0.0": | |
| 68, | |
| "assert@4.1.0": | |
| 65, | |
| "assert@5.0.0": | |
| 78, | |
| "assert@6.0.0": | |
| 64, | |
| "assert-multiple@0.2.0": | |
| 229, | |
| "assert-multiple@0.2.1": | |
| 76, | |
| "assertion-error@0.1.0": | |
| 92, | |
| "assertion-error@0.1.1": | |
| 112, | |
| "assertion-error@0.1.2": | |
| 43, | |
| "assertion-error@0.1.3": | |
| 69, | |
| "assertion-error@0.1.4": | |
| 69, | |
| "assertion-error@0.1.5": | |
| 67, | |
| "assertions-deepdiff@0.1.0": | |
| -464, | |
| "asyncstorage-free@0.1.0": | |
| 473, | |
| "asyncstorage-free@0.1.1": | |
| 581, | |
| "atomic-react@0.0.2": | |
| 50, | |
| "atomic-react@0.0.3": | |
| 57, | |
| "atomic-react@0.0.4": | |
| 74, | |
| "atomic-react@0.0.5": | |
| 60, | |
| "atomic-react@0.1.0": | |
| 75, | |
| "atomic-react@0.1.1": | |
| 66, | |
| "atomic-react@0.1.2": | |
| 71, | |
| "atomic-react@0.2.0": | |
| 91, | |
| "atomic-react@0.3.0": | |
| 169, | |
| "atomic-react@0.4.0": | |
| 91, | |
| "atomic-react@0.4.1": | |
| 111, | |
| "atomic-react@0.4.2": | |
| 109, | |
| "atomic-react@0.4.3": | |
| 107, | |
| "atomic-react@0.5.0": | |
| 111, | |
| "atomic-react@0.6.0": | |
| 69, | |
| "atomic-react@0.7.0": | |
| 62, | |
| "atomic-react@0.7.1": | |
| 129, | |
| "atomic-react@1.0.0": | |
| 46, | |
| "atomic-react@1.1.0": | |
| 61, | |
| "audiograph@0.2.0": | |
| 783, | |
| "audiograph@0.2.1": | |
| 725, | |
| "aui@0.1.0": | |
| -725, | |
| "aui@0.1.1": | |
| -635, | |
| "autocomplete@1.0.3": | |
| -103, | |
| "autocomplete@1.0.4": | |
| -120, | |
| "autocomplete@1.1.0": | |
| -117, | |
| "autocomplete@1.1.1": | |
| -112, | |
| "autocomplete@1.2.0": | |
| -111, | |
| "autocomplete@1.2.1": | |
| -111, | |
| "autocomplete@1.2.2": | |
| -227, | |
| "autocomplete@1.3.0": | |
| -92, | |
| "autocomplete@1.3.1": | |
| -97, | |
| "autocomplete@2.0.0": | |
| -109, | |
| "autocomplete@2.1.0": | |
| -105, | |
| "autocomplete@3.0.0": | |
| -449, | |
| "autocomplete@4.0.0": | |
| 537, | |
| "autocomplete@4.0.1": | |
| 643, | |
| "autocomplete@5.0.0": | |
| 271, | |
| "autocomplete@5.0.1": | |
| 273, | |
| "autocomplete@6.0.0": | |
| 283, | |
| "automata@0.1.0": | |
| 76, | |
| "automata@0.2.0": | |
| 105, | |
| "avar@1.0.0": | |
| 78, | |
| "avar@1.0.1": | |
| 83, | |
| "avar@2.0.0": | |
| 166, | |
| "avar@2.0.1": | |
| 72, | |
| "avar@3.0.0": | |
| 224, | |
| "avar@4.0.0": | |
| 121, | |
| "avar@5.0.0": | |
| 108, | |
| "aws-acm@0.0.1": | |
| 586, | |
| "aws-acm@0.0.2": | |
| 658, | |
| "aws-acm@0.0.3": | |
| 556, | |
| "aws-acm@0.1.1": | |
| 594, | |
| "aws-acm@0.1.2": | |
| 734, | |
| "aws-acm@0.2.1": | |
| 551, | |
| "aws-acm@0.3.1": | |
| 559, | |
| "aws-alexaforbusiness@0.0.1": | |
| 573, | |
| "aws-alexaforbusiness@0.0.2": | |
| 568, | |
| "aws-alexaforbusiness@0.0.3": | |
| 567, | |
| "aws-alexaforbusiness@0.1.1": | |
| 570, | |
| "aws-alexaforbusiness@0.1.2": | |
| 726, | |
| "aws-alexaforbusiness@0.2.1": | |
| 547, | |
| "aws-alexaforbusiness@0.3.1": | |
| 553, | |
| "aws-apigateway@0.0.1": | |
| 565, | |
| "aws-apigateway@0.0.2": | |
| 573, | |
| "aws-apigateway@0.0.3": | |
| 570, | |
| "aws-apigateway@0.1.1": | |
| 568, | |
| "aws-apigateway@0.1.2": | |
| 706, | |
| "aws-apigateway@0.2.1": | |
| 549, | |
| "aws-apigateway@0.3.1": | |
| 547, | |
| "aws-applicationautoscaling@0.0.1": | |
| 565, | |
| "aws-applicationautoscaling@0.0.2": | |
| 571, | |
| "aws-applicationautoscaling@0.0.3": | |
| 567, | |
| "aws-applicationautoscaling@0.1.1": | |
| 574, | |
| "aws-applicationautoscaling@0.1.2": | |
| 675, | |
| "aws-applicationautoscaling@0.2.1": | |
| 547, | |
| "aws-applicationautoscaling@0.3.1": | |
| 546, | |
| "aws-appstream@0.0.1": | |
| 564, | |
| "aws-appstream@0.0.2": | |
| 566, | |
| "aws-appstream@0.0.3": | |
| 572, | |
| "aws-appstream@0.1.1": | |
| 566, | |
| "aws-appstream@0.1.2": | |
| 690, | |
| "aws-appstream@0.2.1": | |
| 558, | |
| "aws-appstream@0.3.1": | |
| 546, | |
| "aws-appsync@0.0.1": | |
| 564, | |
| "aws-appsync@0.0.2": | |
| 564, | |
| "aws-appsync@0.0.3": | |
| 565, | |
| "aws-appsync@0.1.1": | |
| 564, | |
| "aws-appsync@0.1.2": | |
| 682, | |
| "aws-appsync@0.2.1": | |
| 556, | |
| "aws-appsync@0.3.1": | |
| 547, | |
| "aws-athena@0.0.1": | |
| 561, | |
| "aws-athena@0.0.2": | |
| 569, | |
| "aws-athena@0.0.3": | |
| 570, | |
| "aws-athena@0.1.1": | |
| 566, | |
| "aws-athena@0.1.2": | |
| 684, | |
| "aws-athena@0.2.1": | |
| 555, | |
| "aws-athena@0.3.1": | |
| 544, | |
| "aws-autoscaling@0.0.1": | |
| 564, | |
| "aws-autoscaling@0.0.2": | |
| 570, | |
| "aws-autoscaling@0.0.3": | |
| 570, | |
| "aws-autoscaling@0.1.1": | |
| 567, | |
| "aws-autoscaling@0.1.2": | |
| 683, | |
| "aws-autoscaling@0.2.1": | |
| 551, | |
| "aws-autoscaling@0.3.1": | |
| 550, | |
| "aws-autoscalingplans@0.0.1": | |
| 560, | |
| "aws-autoscalingplans@0.0.2": | |
| 562, | |
| "aws-autoscalingplans@0.0.3": | |
| 575, | |
| "aws-autoscalingplans@0.1.1": | |
| 578, | |
| "aws-autoscalingplans@0.1.2": | |
| 685, | |
| "aws-autoscalingplans@0.2.1": | |
| 555, | |
| "aws-autoscalingplans@0.3.1": | |
| 545, | |
| "aws-batch@0.0.1": | |
| 567, | |
| "aws-batch@0.0.2": | |
| 561, | |
| "aws-batch@0.0.3": | |
| 570, | |
| "aws-batch@0.1.1": | |
| 566, | |
| "aws-batch@0.1.2": | |
| 696, | |
| "aws-batch@0.2.1": | |
| 548, | |
| "aws-batch@0.3.1": | |
| 542, | |
| "aws-budgets@0.0.1": | |
| 568, | |
| "aws-budgets@0.0.2": | |
| 565, | |
| "aws-budgets@0.0.3": | |
| 566, | |
| "aws-budgets@0.1.1": | |
| 577, | |
| "aws-budgets@0.1.2": | |
| 685, | |
| "aws-budgets@0.2.1": | |
| 550, | |
| "aws-budgets@0.3.1": | |
| 549, | |
| "aws-cloud9@0.0.1": | |
| 565, | |
| "aws-cloud9@0.0.2": | |
| 563, | |
| "aws-cloud9@0.0.3": | |
| 565, | |
| "aws-cloud9@0.1.1": | |
| 566, | |
| "aws-cloud9@0.1.2": | |
| 687, | |
| "aws-cloud9@0.2.1": | |
| 561, | |
| "aws-cloud9@0.3.1": | |
| 543, | |
| "aws-clouddirectory@0.0.1": | |
| 562, | |
| "aws-clouddirectory@0.0.2": | |
| 567, | |
| "aws-clouddirectory@0.0.3": | |
| 575, | |
| "aws-clouddirectory@0.1.1": | |
| 568, | |
| "aws-clouddirectory@0.1.2": | |
| 688, | |
| "aws-clouddirectory@0.2.1": | |
| 551, | |
| "aws-clouddirectory@0.3.1": | |
| 548, | |
| "aws-cloudformation@0.0.1": | |
| 564, | |
| "aws-cloudformation@0.0.2": | |
| 567, | |
| "aws-cloudformation@0.0.3": | |
| 567, | |
| "aws-cloudformation@0.1.1": | |
| 568, | |
| "aws-cloudformation@0.1.2": | |
| 682, | |
| "aws-cloudformation@0.2.1": | |
| 547, | |
| "aws-cloudformation@0.3.1": | |
| 543, | |
| "aws-cloudfront@0.0.1": | |
| 562, | |
| "aws-cloudfront@0.0.2": | |
| 580, | |
| "aws-cloudfront@0.0.3": | |
| 567, | |
| "aws-cloudfront@0.1.1": | |
| 566, | |
| "aws-cloudfront@0.1.2": | |
| 697, | |
| "aws-cloudfront@0.2.1": | |
| 556, | |
| "aws-cloudfront@0.3.1": | |
| 544, | |
| "aws-cloudhsm@0.0.1": | |
| 563, | |
| "aws-cloudhsm@0.0.2": | |
| 564, | |
| "aws-cloudhsm@0.0.3": | |
| 567, | |
| "aws-cloudhsm@0.1.1": | |
| 571, | |
| "aws-cloudhsm@0.1.2": | |
| 686, | |
| "aws-cloudhsm@0.2.1": | |
| 556, | |
| "aws-cloudhsm@0.3.1": | |
| 551, | |
| "aws-cloudhsmv2@0.0.1": | |
| 568, | |
| "aws-cloudhsmv2@0.0.2": | |
| 571, | |
| "aws-cloudhsmv2@0.0.3": | |
| 568, | |
| "aws-cloudhsmv2@0.1.1": | |
| 569, | |
| "aws-cloudhsmv2@0.1.2": | |
| 694, | |
| "aws-cloudhsmv2@0.2.1": | |
| 551, | |
| "aws-cloudhsmv2@0.3.1": | |
| 545, | |
| "aws-cloudsearch@0.0.1": | |
| 562, | |
| "aws-cloudsearch@0.0.2": | |
| 563, | |
| "aws-cloudsearch@0.0.3": | |
| 570, | |
| "aws-cloudsearch@0.1.1": | |
| 566, | |
| "aws-cloudsearch@0.1.2": | |
| 682, | |
| "aws-cloudsearch@0.2.1": | |
| 555, | |
| "aws-cloudsearch@0.3.1": | |
| 553, | |
| "aws-cloudsearchdomain@0.0.1": | |
| 560, | |
| "aws-cloudsearchdomain@0.0.2": | |
| 561, | |
| "aws-cloudsearchdomain@0.0.3": | |
| 563, | |
| "aws-cloudsearchdomain@0.1.1": | |
| 567, | |
| "aws-cloudsearchdomain@0.1.2": | |
| 679, | |
| "aws-cloudsearchdomain@0.2.1": | |
| 549, | |
| "aws-cloudsearchdomain@0.3.1": | |
| 542, | |
| "aws-cloudtrail@0.0.1": | |
| 558, | |
| "aws-cloudtrail@0.0.2": | |
| 570, | |
| "aws-cloudtrail@0.0.3": | |
| 564, | |
| "aws-cloudtrail@0.1.1": | |
| 565, | |
| "aws-cloudtrail@0.1.2": | |
| 689, | |
| "aws-cloudtrail@0.2.1": | |
| 550, | |
| "aws-cloudtrail@0.3.1": | |
| 542, | |
| "aws-cloudwatch@0.0.1": | |
| 562, | |
| "aws-cloudwatch@0.0.2": | |
| 563, | |
| "aws-cloudwatch@0.0.3": | |
| 583, | |
| "aws-cloudwatch@0.1.1": | |
| 567, | |
| "aws-cloudwatch@0.1.2": | |
| 689, | |
| "aws-cloudwatch@0.2.1": | |
| 547, | |
| "aws-cloudwatch@0.3.1": | |
| 541, | |
| "aws-cloudwatchevents@0.0.1": | |
| 562, | |
| "aws-cloudwatchevents@0.0.2": | |
| 561, | |
| "aws-cloudwatchevents@0.0.3": | |
| 564, | |
| "aws-cloudwatchevents@0.1.1": | |
| 561, | |
| "aws-cloudwatchevents@0.1.2": | |
| 677, | |
| "aws-cloudwatchevents@0.2.1": | |
| 549, | |
| "aws-cloudwatchevents@0.3.1": | |
| 542, | |
| "aws-cloudwatchlogs@0.0.1": | |
| 573, | |
| "aws-cloudwatchlogs@0.0.2": | |
| 562, | |
| "aws-cloudwatchlogs@0.0.3": | |
| 565, | |
| "aws-cloudwatchlogs@0.1.1": | |
| 570, | |
| "aws-cloudwatchlogs@0.1.2": | |
| 681, | |
| "aws-cloudwatchlogs@0.2.1": | |
| 556, | |
| "aws-cloudwatchlogs@0.3.1": | |
| 542, | |
| "aws-codebuild@0.0.1": | |
| 559, | |
| "aws-codebuild@0.0.2": | |
| 568, | |
| "aws-codebuild@0.0.3": | |
| 565, | |
| "aws-codebuild@0.1.1": | |
| 564, | |
| "aws-codebuild@0.1.2": | |
| 687, | |
| "aws-codebuild@0.2.1": | |
| 551, | |
| "aws-codebuild@0.3.1": | |
| 542, | |
| "aws-codecommit@0.0.1": | |
| 560, | |
| "aws-codecommit@0.0.2": | |
| 562, | |
| "aws-codecommit@0.0.3": | |
| 575, | |
| "aws-codecommit@0.1.1": | |
| 565, | |
| "aws-codecommit@0.1.2": | |
| 686, | |
| "aws-codecommit@0.2.1": | |
| 548, | |
| "aws-codecommit@0.3.1": | |
| 546, | |
| "aws-codedeploy@0.0.1": | |
| 562, | |
| "aws-codedeploy@0.0.2": | |
| 564, | |
| "aws-codedeploy@0.0.3": | |
| 576, | |
| "aws-codedeploy@0.1.1": | |
| 566, | |
| "aws-codedeploy@0.1.2": | |
| 683, | |
| "aws-codedeploy@0.2.1": | |
| 556, | |
| "aws-codedeploy@0.3.1": | |
| 547, | |
| "aws-codepipeline@0.0.1": | |
| 560, | |
| "aws-codepipeline@0.0.2": | |
| 569, | |
| "aws-codepipeline@0.0.3": | |
| 568, | |
| "aws-codepipeline@0.1.1": | |
| 567, | |
| "aws-codepipeline@0.1.2": | |
| 689, | |
| "aws-codepipeline@0.2.1": | |
| 547, | |
| "aws-codepipeline@0.3.1": | |
| 537, | |
| "aws-codestar@0.0.1": | |
| 563, | |
| "aws-codestar@0.0.2": | |
| 563, | |
| "aws-codestar@0.0.3": | |
| 569, | |
| "aws-codestar@0.1.1": | |
| 567, | |
| "aws-codestar@0.1.2": | |
| 688, | |
| "aws-codestar@0.2.1": | |
| 552, | |
| "aws-codestar@0.3.1": | |
| 543, | |
| "aws-cognitoidentity@0.0.1": | |
| 585, | |
| "aws-cognitoidentity@0.0.2": | |
| 569, | |
| "aws-cognitoidentity@0.0.3": | |
| 572, | |
| "aws-cognitoidentity@0.1.1": | |
| 567, | |
| "aws-cognitoidentity@0.1.2": | |
| 687, | |
| "aws-cognitoidentity@0.2.1": | |
| 548, | |
| "aws-cognitoidentity@0.3.1": | |
| 539, | |
| "aws-cognitoidentityserviceprovider@0.0.1": | |
| 565, | |
| "aws-cognitoidentityserviceprovider@0.0.2": | |
| 563, | |
| "aws-cognitoidentityserviceprovider@0.0.3": | |
| 566, | |
| "aws-cognitoidentityserviceprovider@0.1.1": | |
| 579, | |
| "aws-cognitoidentityserviceprovider@0.1.2": | |
| 684, | |
| "aws-cognitoidentityserviceprovider@0.2.1": | |
| 558, | |
| "aws-cognitoidentityserviceprovider@0.3.1": | |
| 538, | |
| "aws-cognitosync@0.0.1": | |
| 559, | |
| "aws-cognitosync@0.0.2": | |
| 564, | |
| "aws-cognitosync@0.0.3": | |
| 573, | |
| "aws-cognitosync@0.1.1": | |
| 572, | |
| "aws-cognitosync@0.1.2": | |
| 690, | |
| "aws-cognitosync@0.2.1": | |
| 551, | |
| "aws-cognitosync@0.3.1": | |
| 539, | |
| "aws-comprehend@0.0.1": | |
| 565, | |
| "aws-comprehend@0.0.2": | |
| 564, | |
| "aws-comprehend@0.0.3": | |
| 563, | |
| "aws-comprehend@0.1.1": | |
| 573, | |
| "aws-comprehend@0.1.2": | |
| 707, | |
| "aws-comprehend@0.2.1": | |
| 553, | |
| "aws-comprehend@0.3.1": | |
| 552, | |
| "aws-configservice@0.0.1": | |
| 592, | |
| "aws-configservice@0.0.2": | |
| 584, | |
| "aws-configservice@0.0.3": | |
| 567, | |
| "aws-configservice@0.1.1": | |
| 566, | |
| "aws-configservice@0.1.2": | |
| 685, | |
| "aws-configservice@0.2.1": | |
| 553, | |
| "aws-configservice@0.3.1": | |
| 539, | |
| "aws-costexplorer@0.0.1": | |
| 569, | |
| "aws-costexplorer@0.0.2": | |
| 570, | |
| "aws-costexplorer@0.0.3": | |
| 567, | |
| "aws-costexplorer@0.1.1": | |
| 566, | |
| "aws-costexplorer@0.1.2": | |
| 681, | |
| "aws-costexplorer@0.2.1": | |
| 549, | |
| "aws-costexplorer@0.3.1": | |
| 539, | |
| "aws-cur@0.0.1": | |
| 564, | |
| "aws-cur@0.0.2": | |
| 562, | |
| "aws-cur@0.0.3": | |
| 571, | |
| "aws-cur@0.1.1": | |
| 567, | |
| "aws-cur@0.1.2": | |
| 682, | |
| "aws-cur@0.2.1": | |
| 553, | |
| "aws-cur@0.3.1": | |
| 541, | |
| "aws-datapipeline@0.0.1": | |
| 563, | |
| "aws-datapipeline@0.0.2": | |
| 564, | |
| "aws-datapipeline@0.0.3": | |
| 561, | |
| "aws-datapipeline@0.1.1": | |
| 570, | |
| "aws-datapipeline@0.1.2": | |
| 683, | |
| "aws-datapipeline@0.2.1": | |
| 555, | |
| "aws-datapipeline@0.3.1": | |
| 543, | |
| "aws-dax@0.0.1": | |
| 574, | |
| "aws-dax@0.0.2": | |
| 562, | |
| "aws-dax@0.0.3": | |
| 561, | |
| "aws-dax@0.1.1": | |
| 567, | |
| "aws-dax@0.1.2": | |
| 684, | |
| "aws-dax@0.2.1": | |
| 550, | |
| "aws-dax@0.3.1": | |
| 543, | |
| "aws-devicefarm@0.0.1": | |
| 557, | |
| "aws-devicefarm@0.0.2": | |
| 561, | |
| "aws-devicefarm@0.0.3": | |
| 571, | |
| "aws-devicefarm@0.1.1": | |
| 566, | |
| "aws-devicefarm@0.1.2": | |
| 685, | |
| "aws-devicefarm@0.2.1": | |
| 552, | |
| "aws-devicefarm@0.3.1": | |
| 539, | |
| "aws-directconnect@0.0.1": | |
| 569, | |
| "aws-directconnect@0.0.2": | |
| 559, | |
| "aws-directconnect@0.0.3": | |
| 559, | |
| "aws-directconnect@0.1.1": | |
| 568, | |
| "aws-directconnect@0.1.2": | |
| 676, | |
| "aws-directconnect@0.2.1": | |
| 549, | |
| "aws-directconnect@0.3.1": | |
| 540, | |
| "aws-directoryservice@0.0.1": | |
| 556, | |
| "aws-directoryservice@0.0.2": | |
| 561, | |
| "aws-directoryservice@0.0.3": | |
| 568, | |
| "aws-directoryservice@0.1.1": | |
| 602, | |
| "aws-directoryservice@0.1.2": | |
| 682, | |
| "aws-directoryservice@0.2.1": | |
| 551, | |
| "aws-directoryservice@0.3.1": | |
| 543, | |
| "aws-discovery@0.0.1": | |
| 559, | |
| "aws-discovery@0.0.2": | |
| 567, | |
| "aws-discovery@0.0.3": | |
| 560, | |
| "aws-discovery@0.1.1": | |
| 570, | |
| "aws-discovery@0.1.2": | |
| 681, | |
| "aws-discovery@0.2.1": | |
| 551, | |
| "aws-discovery@0.3.1": | |
| 537, | |
| "aws-dms@0.0.1": | |
| 560, | |
| "aws-dms@0.0.2": | |
| 563, | |
| "aws-dms@0.0.3": | |
| 562, | |
| "aws-dms@0.1.1": | |
| 570, | |
| "aws-dms@0.1.2": | |
| 682, | |
| "aws-dms@0.2.1": | |
| 554, | |
| "aws-dms@0.3.1": | |
| 541, | |
| "aws-dynamodb@0.0.1": | |
| 560, | |
| "aws-dynamodb@0.0.2": | |
| 561, | |
| "aws-dynamodb@0.0.3": | |
| 561, | |
| "aws-dynamodb@0.1.1": | |
| 567, | |
| "aws-dynamodb@0.1.2": | |
| 687, | |
| "aws-dynamodb@0.2.1": | |
| 548, | |
| "aws-dynamodb@0.3.1": | |
| 541, | |
| "aws-dynamodbstreams@0.0.1": | |
| 564, | |
| "aws-dynamodbstreams@0.0.2": | |
| 562, | |
| "aws-dynamodbstreams@0.0.3": | |
| 561, | |
| "aws-dynamodbstreams@0.1.1": | |
| 567, | |
| "aws-dynamodbstreams@0.1.2": | |
| 679, | |
| "aws-dynamodbstreams@0.2.1": | |
| 553, | |
| "aws-dynamodbstreams@0.3.1": | |
| 545, | |
| "aws-ec2@0.0.1": | |
| 559, | |
| "aws-ec2@0.0.2": | |
| 569, | |
| "aws-ec2@0.0.3": | |
| 568, | |
| "aws-ec2@0.1.1": | |
| 563, | |
| "aws-ec2@0.1.2": | |
| 688, | |
| "aws-ec2@0.2.1": | |
| 555, | |
| "aws-ec2@0.3.1": | |
| 536, | |
| "aws-ecr@0.0.1": | |
| 559, | |
| "aws-ecr@0.0.2": | |
| 567, | |
| "aws-ecr@0.0.3": | |
| 562, | |
| "aws-ecr@0.1.1": | |
| 576, | |
| "aws-ecr@0.1.2": | |
| 679, | |
| "aws-ecr@0.2.1": | |
| 549, | |
| "aws-ecr@0.3.1": | |
| 541, | |
| "aws-ecs@0.0.1": | |
| 558, | |
| "aws-ecs@0.0.2": | |
| 564, | |
| "aws-ecs@0.0.3": | |
| 571, | |
| "aws-ecs@0.1.1": | |
| 564, | |
| "aws-ecs@0.1.2": | |
| 690, | |
| "aws-ecs@0.2.1": | |
| 546, | |
| "aws-ecs@0.3.1": | |
| 539, | |
| "aws-efs@0.0.1": | |
| 556, | |
| "aws-efs@0.0.2": | |
| 559, | |
| "aws-efs@0.0.3": | |
| 564, | |
| "aws-efs@0.1.1": | |
| 565, | |
| "aws-efs@0.1.2": | |
| 671, | |
| "aws-efs@0.2.1": | |
| 548, | |
| "aws-efs@0.3.1": | |
| 538, | |
| "aws-elasticache@0.0.1": | |
| 557, | |
| "aws-elasticache@0.0.2": | |
| 560, | |
| "aws-elasticache@0.1.1": | |
| 563, | |
| "aws-elasticache@0.1.2": | |
| 563, | |
| "aws-elasticache@0.2.1": | |
| 671, | |
| "aws-elasticache@0.3.1": | |
| 538, | |
| "aws-elasticbeanstalk@0.0.1": | |
| 547, | |
| "aws-elasticbeanstalk@0.0.2": | |
| 559, | |
| "aws-elasticbeanstalk@0.1.1": | |
| 570, | |
| "aws-elasticbeanstalk@0.1.2": | |
| 564, | |
| "aws-elasticbeanstalk@0.2.1": | |
| 564, | |
| "aws-elasticbeanstalk@0.3.1": | |
| 673, | |
| "aws-elastictranscoder@0.0.1": | |
| 553, | |
| "aws-elastictranscoder@0.0.2": | |
| 550, | |
| "aws-elastictranscoder@0.1.1": | |
| 561, | |
| "aws-elastictranscoder@0.1.2": | |
| 563, | |
| "aws-elastictranscoder@0.2.1": | |
| 562, | |
| "aws-elastictranscoder@0.3.1": | |
| 566, | |
| "aws-elb@0.0.1": | |
| 681, | |
| "aws-elb@0.0.2": | |
| 552, | |
| "aws-elb@0.1.1": | |
| 551, | |
| "aws-elb@0.1.2": | |
| 560, | |
| "aws-elb@0.2.1": | |
| 563, | |
| "aws-elb@0.3.1": | |
| 557, | |
| "aws-elbv2@0.0.1": | |
| 562, | |
| "aws-elbv2@0.0.2": | |
| 687, | |
| "aws-elbv2@0.1.1": | |
| 554, | |
| "aws-elbv2@0.1.2": | |
| 546, | |
| "aws-elbv2@0.2.1": | |
| 562, | |
| "aws-elbv2@0.3.1": | |
| 551, | |
| "aws-emr@0.0.1": | |
| 560, | |
| "aws-emr@0.0.2": | |
| 563, | |
| "aws-emr@0.1.1": | |
| 685, | |
| "aws-emr@0.1.2": | |
| 546, | |
| "aws-emr@0.2.1": | |
| 555, | |
| "aws-emr@0.3.1": | |
| 547, | |
| "aws-encryption-sdk@0.1.0": | |
| 455, | |
| "aws-encryption-sdk@0.2.0": | |
| -350, | |
| "aws-es@0.0.1": | |
| 569, | |
| "aws-es@0.0.2": | |
| 689, | |
| "aws-es@0.1.1": | |
| 550, | |
| "aws-es@0.1.2": | |
| 547, | |
| "aws-es@0.2.1": | |
| 557, | |
| "aws-es@0.3.1": | |
| 555, | |
| "aws-firehose@0.0.1": | |
| 564, | |
| "aws-firehose@0.0.2": | |
| 568, | |
| "aws-firehose@0.1.1": | |
| 693, | |
| "aws-firehose@0.1.2": | |
| 553, | |
| "aws-firehose@0.2.1": | |
| 549, | |
| "aws-firehose@0.3.1": | |
| 564, | |
| "aws-gamelift@0.0.1": | |
| 562, | |
| "aws-gamelift@0.0.2": | |
| 564, | |
| "aws-gamelift@0.1.1": | |
| 565, | |
| "aws-gamelift@0.1.2": | |
| 679, | |
| "aws-gamelift@0.2.1": | |
| 553, | |
| "aws-gamelift@0.3.1": | |
| 534, | |
| "aws-glacier@0.0.1": | |
| 561, | |
| "aws-glacier@0.0.2": | |
| 559, | |
| "aws-glacier@0.1.1": | |
| 631, | |
| "aws-glacier@0.1.2": | |
| 569, | |
| "aws-glacier@0.2.1": | |
| 673, | |
| "aws-glacier@0.3.1": | |
| 535, | |
| "aws-glue@0.0.1": | |
| 548, | |
| "aws-glue@0.0.2": | |
| 561, | |
| "aws-glue@0.1.1": | |
| 561, | |
| "aws-glue@0.1.2": | |
| 561, | |
| "aws-glue@0.2.1": | |
| 565, | |
| "aws-glue@0.3.1": | |
| 682, | |
| "aws-greengrass@0.0.1": | |
| 556, | |
| "aws-greengrass@0.0.2": | |
| 550, | |
| "aws-greengrass@0.1.1": | |
| 562, | |
| "aws-greengrass@0.1.2": | |
| 560, | |
| "aws-greengrass@0.2.1": | |
| 563, | |
| "aws-greengrass@0.3.1": | |
| 553, | |
| "aws-guardduty@0.0.1": | |
| 679, | |
| "aws-guardduty@0.0.2": | |
| 558, | |
| "aws-guardduty@0.1.1": | |
| 552, | |
| "aws-guardduty@0.1.2": | |
| 562, | |
| "aws-guardduty@0.2.1": | |
| 573, | |
| "aws-guardduty@0.3.1": | |
| 563, | |
| "aws-health@0.0.1": | |
| 565, | |
| "aws-health@0.0.2": | |
| 683, | |
| "aws-health@0.1.1": | |
| 553, | |
| "aws-health@0.1.2": | |
| 545, | |
| "aws-health@0.2.1": | |
| 571, | |
| "aws-health@0.3.1": | |
| 550, | |
| "aws-iam@0.0.1": | |
| 570, | |
| "aws-iam@0.0.2": | |
| 564, | |
| "aws-iam@0.1.1": | |
| 681, | |
| "aws-iam@0.1.2": | |
| 548, | |
| "aws-iam@0.2.1": | |
| 547, | |
| "aws-iam@0.3.1": | |
| 553, | |
| "aws-importexport@0.0.1": | |
| 563, | |
| "aws-importexport@0.0.2": | |
| 561, | |
| "aws-importexport@0.1.1": | |
| 565, | |
| "aws-importexport@0.1.2": | |
| 683, | |
| "aws-importexport@0.2.1": | |
| 553, | |
| "aws-importexport@0.3.1": | |
| 534, | |
| "aws-inspector@0.0.1": | |
| 561, | |
| "aws-inspector@0.0.2": | |
| 563, | |
| "aws-inspector@0.1.1": | |
| 561, | |
| "aws-inspector@0.1.2": | |
| 567, | |
| "aws-inspector@0.2.1": | |
| 684, | |
| "aws-inspector@0.3.1": | |
| 549, | |
| "aws-iot@0.0.1": | |
| 550, | |
| "aws-iot@0.0.2": | |
| 558, | |
| "aws-iot@0.1.1": | |
| 562, | |
| "aws-iot@0.1.2": | |
| 561, | |
| "aws-iot@0.2.1": | |
| 571, | |
| "aws-iot@0.3.1": | |
| 669, | |
| "aws-iotdata@0.0.1": | |
| 549, | |
| "aws-iotdata@0.0.2": | |
| 544, | |
| "aws-iotdata@0.1.1": | |
| 560, | |
| "aws-iotdata@0.1.2": | |
| 566, | |
| "aws-iotdata@0.2.1": | |
| 563, | |
| "aws-iotdata@0.3.1": | |
| 551, | |
| "aws-iotjobsdataplane@0.0.1": | |
| 679, | |
| "aws-iotjobsdataplane@0.0.2": | |
| 551, | |
| "aws-iotjobsdataplane@0.1.1": | |
| 550, | |
| "aws-iotjobsdataplane@0.1.2": | |
| 560, | |
| "aws-iotjobsdataplane@0.2.1": | |
| 562, | |
| "aws-iotjobsdataplane@0.3.1": | |
| 559, | |
| "aws-kinesis@0.0.1": | |
| 564, | |
| "aws-kinesis@0.0.2": | |
| 679, | |
| "aws-kinesis@0.1.1": | |
| 553, | |
| "aws-kinesis@0.1.2": | |
| 546, | |
| "aws-kinesis@0.2.1": | |
| 562, | |
| "aws-kinesis@0.3.1": | |
| 550, | |
| "aws-kinesisanalytics@0.0.1": | |
| 570, | |
| "aws-kinesisanalytics@0.0.2": | |
| 565, | |
| "aws-kinesisanalytics@0.1.1": | |
| 691, | |
| "aws-kinesisanalytics@0.1.2": | |
| 550, | |
| "aws-kinesisanalytics@0.2.1": | |
| 546, | |
| "aws-kinesisanalytics@0.3.1": | |
| 562, | |
| "aws-kinesisvideo@0.0.1": | |
| 562, | |
| "aws-kinesisvideo@0.0.2": | |
| 566, | |
| "aws-kinesisvideo@0.1.1": | |
| 573, | |
| "aws-kinesisvideo@0.1.2": | |
| 681, | |
| "aws-kinesisvideo@0.2.1": | |
| 550, | |
| "aws-kinesisvideo@0.3.1": | |
| 543, | |
| "aws-kinesisvideoarchivedmedia@0.0.1": | |
| 560, | |
| "aws-kinesisvideoarchivedmedia@0.0.2": | |
| 561, | |
| "aws-kinesisvideoarchivedmedia@0.1.1": | |
| 564, | |
| "aws-kinesisvideoarchivedmedia@0.1.2": | |
| 571, | |
| "aws-kinesisvideoarchivedmedia@0.2.1": | |
| 680, | |
| "aws-kinesisvideoarchivedmedia@0.3.1": | |
| 541, | |
| "aws-kinesisvideomedia@0.0.1": | |
| 547, | |
| "aws-kinesisvideomedia@0.0.2": | |
| 565, | |
| "aws-kinesisvideomedia@0.1.1": | |
| 562, | |
| "aws-kinesisvideomedia@0.1.2": | |
| 564, | |
| "aws-kinesisvideomedia@0.2.1": | |
| 570, | |
| "aws-kinesisvideomedia@0.3.1": | |
| 679, | |
| "aws-kms@0.0.1": | |
| 548, | |
| "aws-kms@0.0.2": | |
| 550, | |
| "aws-kms@0.1.1": | |
| 566, | |
| "aws-kms@0.1.2": | |
| 562, | |
| "aws-kms@0.2.1": | |
| 570, | |
| "aws-kms@0.3.1": | |
| 553, | |
| "aws-lambda@0.0.1": | |
| 682, | |
| "aws-lambda@0.0.2": | |
| 553, | |
| "aws-lambda@0.1.1": | |
| 547, | |
| "aws-lambda@0.1.2": | |
| 560, | |
| "aws-lambda@0.2.1": | |
| 561, | |
| "aws-lambda@0.3.1": | |
| 556, | |
| "aws-lambda-express@1.0.0": | |
| 591, | |
| "aws-lambda-express@1.0.1": | |
| 709, | |
| "aws-lambda-express@1.0.2": | |
| 567, | |
| "aws-lambda-express@2.0.0": | |
| 505, | |
| "aws-lexmodelbuildingservice@0.0.1": | |
| 563, | |
| "aws-lexmodelbuildingservice@0.0.2": | |
| 560, | |
| "aws-lexmodelbuildingservice@0.1.1": | |
| 562, | |
| "aws-lexmodelbuildingservice@0.1.2": | |
| 564, | |
| "aws-lexmodelbuildingservice@0.2.1": | |
| 702, | |
| "aws-lexmodelbuildingservice@0.3.1": | |
| 541, | |
| "aws-lexruntime@0.0.1": | |
| 549, | |
| "aws-lexruntime@0.0.2": | |
| 560, | |
| "aws-lexruntime@0.1.1": | |
| 562, | |
| "aws-lexruntime@0.1.2": | |
| 560, | |
| "aws-lexruntime@0.2.1": | |
| 565, | |
| "aws-lexruntime@0.3.1": | |
| 692, | |
| "aws-lightsail@0.0.1": | |
| 553, | |
| "aws-lightsail@0.0.2": | |
| 551, | |
| "aws-lightsail@0.1.1": | |
| 567, | |
| "aws-lightsail@0.1.2": | |
| 565, | |
| "aws-lightsail@0.2.1": | |
| 570, | |
| "aws-lightsail@0.3.1": | |
| 653, | |
| "aws-machinelearning@0.0.1": | |
| 550, | |
| "aws-machinelearning@0.1.1": | |
| 548, | |
| "aws-machinelearning@0.1.2": | |
| 559, | |
| "aws-machinelearning@0.2.1": | |
| 565, | |
| "aws-machinelearning@0.3.1": | |
| 556, | |
| "aws-marketplacecommerceanalytics@0.0.1": | |
| 573, | |
| "aws-marketplacecommerceanalytics@0.1.1": | |
| 681, | |
| "aws-marketplacecommerceanalytics@0.1.2": | |
| 583, | |
| "aws-marketplacecommerceanalytics@0.2.1": | |
| 550, | |
| "aws-marketplacecommerceanalytics@0.3.1": | |
| 553, | |
| "aws-marketplaceentitlementservice@0.0.1": | |
| 564, | |
| "aws-marketplaceentitlementservice@0.1.1": | |
| 564, | |
| "aws-marketplaceentitlementservice@0.1.2": | |
| 565, | |
| "aws-marketplaceentitlementservice@0.2.1": | |
| 681, | |
| "aws-marketplaceentitlementservice@0.3.1": | |
| 542, | |
| "aws-marketplacemetering@0.0.1": | |
| 547, | |
| "aws-marketplacemetering@0.1.1": | |
| 560, | |
| "aws-marketplacemetering@0.1.2": | |
| 561, | |
| "aws-marketplacemetering@0.2.1": | |
| 562, | |
| "aws-marketplacemetering@0.3.1": | |
| 555, | |
| "aws-mediaconvert@0.0.1": | |
| 689, | |
| "aws-mediaconvert@0.1.1": | |
| 552, | |
| "aws-mediaconvert@0.1.2": | |
| 555, | |
| "aws-mediaconvert@0.2.1": | |
| 561, | |
| "aws-mediaconvert@0.3.1": | |
| 549, | |
| "aws-medialive@0.0.1": | |
| 563, | |
| "aws-medialive@0.1.1": | |
| 569, | |
| "aws-medialive@0.1.2": | |
| 688, | |
| "aws-medialive@0.2.1": | |
| 553, | |
| "aws-medialive@0.3.1": | |
| 539, | |
| "aws-mediapackage@0.0.1": | |
| 561, | |
| "aws-mediapackage@0.1.1": | |
| 566, | |
| "aws-mediapackage@0.1.2": | |
| 564, | |
| "aws-mediapackage@0.2.1": | |
| 569, | |
| "aws-mediapackage@0.3.1": | |
| 680, | |
| "aws-mediastore@0.0.1": | |
| 554, | |
| "aws-mediastore@0.1.1": | |
| 544, | |
| "aws-mediastore@0.1.2": | |
| 562, | |
| "aws-mediastore@0.2.1": | |
| 560, | |
| "aws-mediastore@0.3.1": | |
| 552, | |
| "aws-mediastoredata@0.0.1": | |
| 576, | |
| "aws-mediastoredata@0.1.1": | |
| 671, | |
| "aws-mediastoredata@0.1.2": | |
| 556, | |
| "aws-mediastoredata@0.2.1": | |
| 548, | |
| "aws-mediastoredata@0.3.1": | |
| 551, | |
| "aws-migrationhub@0.0.1": | |
| 564, | |
| "aws-migrationhub@0.1.1": | |
| 568, | |
| "aws-migrationhub@0.1.2": | |
| 564, | |
| "aws-migrationhub@0.2.1": | |
| 690, | |
| "aws-migrationhub@0.3.1": | |
| 547, | |
| "aws-mobile@0.0.1": | |
| 554, | |
| "aws-mobile@0.1.1": | |
| 562, | |
| "aws-mobile@0.1.2": | |
| 563, | |
| "aws-mobile@0.2.1": | |
| 564, | |
| "aws-mobile@0.3.1": | |
| 556, | |
| "aws-mobileanalytics@0.0.1": | |
| 692, | |
| "aws-mobileanalytics@0.1.1": | |
| 552, | |
| "aws-mobileanalytics@0.1.2": | |
| 556, | |
| "aws-mobileanalytics@0.2.1": | |
| 564, | |
| "aws-mobileanalytics@0.3.1": | |
| 553, | |
| "aws-mq@0.0.1": | |
| 565, | |
| "aws-mq@0.1.1": | |
| 566, | |
| "aws-mq@0.1.2": | |
| 692, | |
| "aws-mq@0.2.1": | |
| 560, | |
| "aws-mq@0.3.1": | |
| 534, | |
| "aws-mturk@0.0.1": | |
| 564, | |
| "aws-mturk@0.1.1": | |
| 565, | |
| "aws-mturk@0.1.2": | |
| 568, | |
| "aws-mturk@0.2.1": | |
| 566, | |
| "aws-mturk@0.3.1": | |
| 677, | |
| "aws-opsworks@0.0.1": | |
| 561, | |
| "aws-opsworks@0.1.1": | |
| 546, | |
| "aws-opsworks@0.1.2": | |
| 570, | |
| "aws-opsworks@0.2.1": | |
| 577, | |
| "aws-opsworks@0.3.1": | |
| 562, | |
| "aws-opsworkscm@0.0.1": | |
| 567, | |
| "aws-opsworkscm@0.1.1": | |
| 681, | |
| "aws-opsworkscm@0.1.2": | |
| 552, | |
| "aws-opsworkscm@0.2.1": | |
| 543, | |
| "aws-opsworkscm@0.3.1": | |
| 550, | |
| "aws-organizations@0.0.1": | |
| 563, | |
| "aws-organizations@0.1.1": | |
| 567, | |
| "aws-organizations@0.1.2": | |
| 565, | |
| "aws-organizations@0.2.1": | |
| 697, | |
| "aws-organizations@0.3.1": | |
| 543, | |
| "aws-pinpoint@0.0.1": | |
| 549, | |
| "aws-pinpoint@0.1.1": | |
| 561, | |
| "aws-pinpoint@0.1.2": | |
| 561, | |
| "aws-pinpoint@0.2.1": | |
| 565, | |
| "aws-pinpoint@0.3.1": | |
| 555, | |
| "aws-polly@0.0.1": | |
| 688, | |
| "aws-polly@0.1.1": | |
| 554, | |
| "aws-polly@0.1.2": | |
| 549, | |
| "aws-polly@0.2.1": | |
| 561, | |
| "aws-polly@0.3.1": | |
| 550, | |
| "aws-pricing@0.0.1": | |
| 565, | |
| "aws-pricing@0.1.1": | |
| 566, | |
| "aws-pricing@0.1.2": | |
| 678, | |
| "aws-pricing@0.2.1": | |
| 562, | |
| "aws-pricing@0.3.1": | |
| 536, | |
| "aws-rds@0.0.1": | |
| 567, | |
| "aws-rds@0.1.1": | |
| 565, | |
| "aws-rds@0.1.2": | |
| 566, | |
| "aws-rds@0.2.1": | |
| 568, | |
| "aws-rds@0.3.1": | |
| 708, | |
| "aws-redshift@0.0.1": | |
| 554, | |
| "aws-redshift@0.1.1": | |
| 558, | |
| "aws-redshift@0.1.2": | |
| 563, | |
| "aws-redshift@0.2.1": | |
| 562, | |
| "aws-redshift@0.3.1": | |
| 559, | |
| "aws-rekognition@0.0.1": | |
| 563, | |
| "aws-rekognition@0.1.1": | |
| 683, | |
| "aws-rekognition@0.1.2": | |
| 556, | |
| "aws-rekognition@0.2.1": | |
| 545, | |
| "aws-rekognition@0.3.1": | |
| 553, | |
| "aws-request@0.0.1": | |
| 486, | |
| "aws-request@0.0.2": | |
| 493, | |
| "aws-request@0.0.5": | |
| 444, | |
| "aws-request@0.0.6": | |
| 566, | |
| "aws-request@0.0.7": | |
| 431, | |
| "aws-request@0.0.24": | |
| 427, | |
| "aws-request@0.0.25": | |
| 439, | |
| "aws-request@0.0.26": | |
| 440, | |
| "aws-request@0.0.28": | |
| 442, | |
| "aws-request@0.0.30": | |
| 441, | |
| "aws-request@0.1.0": | |
| 559, | |
| "aws-request@0.1.1": | |
| 437, | |
| "aws-request@0.1.2": | |
| 421, | |
| "aws-request@0.1.3": | |
| 440, | |
| "aws-request@0.1.4": | |
| 441, | |
| "aws-request@0.1.5": | |
| 442, | |
| "aws-request@0.2.1": | |
| 449, | |
| "aws-request@0.2.2": | |
| 552, | |
| "aws-request@0.3.1": | |
| 429, | |
| "aws-request@0.3.2": | |
| 416, | |
| "aws-resourcegroups@0.0.1": | |
| 561, | |
| "aws-resourcegroups@0.1.1": | |
| 562, | |
| "aws-resourcegroups@0.1.2": | |
| 570, | |
| "aws-resourcegroups@0.2.1": | |
| 566, | |
| "aws-resourcegroups@0.3.1": | |
| 682, | |
| "aws-resourcegroupstaggingapi@0.0.1": | |
| 554, | |
| "aws-resourcegroupstaggingapi@0.1.1": | |
| 544, | |
| "aws-resourcegroupstaggingapi@0.1.2": | |
| 558, | |
| "aws-resourcegroupstaggingapi@0.2.1": | |
| 562, | |
| "aws-resourcegroupstaggingapi@0.3.1": | |
| 555, | |
| "aws-route53@0.0.1": | |
| 566, | |
| "aws-route53@0.1.1": | |
| 682, | |
| "aws-route53@0.1.2": | |
| 558, | |
| "aws-route53@0.2.1": | |
| 546, | |
| "aws-route53@0.3.1": | |
| 551, | |
| "aws-route53domains@0.0.1": | |
| 562, | |
| "aws-route53domains@0.1.1": | |
| 568, | |
| "aws-route53domains@0.1.2": | |
| 565, | |
| "aws-route53domains@0.2.1": | |
| 682, | |
| "aws-route53domains@0.3.1": | |
| 540, | |
| "aws-s3@0.0.1": | |
| 544, | |
| "aws-s3@0.1.1": | |
| 569, | |
| "aws-s3@0.1.2": | |
| 567, | |
| "aws-s3@0.2.1": | |
| 563, | |
| "aws-s3@0.3.1": | |
| 554, | |
| "aws-sagemaker@0.0.1": | |
| 679, | |
| "aws-sagemaker@0.1.1": | |
| 552, | |
| "aws-sagemaker@0.1.2": | |
| 552, | |
| "aws-sagemaker@0.2.1": | |
| 566, | |
| "aws-sagemaker@0.3.1": | |
| 560, | |
| "aws-sagemakerruntime@0.0.1": | |
| 568, | |
| "aws-sagemakerruntime@0.1.1": | |
| 566, | |
| "aws-sagemakerruntime@0.1.2": | |
| 713, | |
| "aws-sagemakerruntime@0.2.1": | |
| 566, | |
| "aws-sagemakerruntime@0.3.1": | |
| 538, | |
| "aws-sdk@0.0.37": | |
| 484, | |
| "aws-sdk@0.0.39": | |
| 480, | |
| "aws-sdk@0.0.42": | |
| 482, | |
| "aws-sdk@0.0.50": | |
| 482, | |
| "aws-sdk@0.0.52": | |
| 601, | |
| "aws-sdk-basic@0.1.0": | |
| 352, | |
| "aws-sdk-basic@0.1.1": | |
| 330, | |
| "aws-sdk-basic@0.2.0": | |
| 350, | |
| "aws-sdk-basic@0.2.1": | |
| 351, | |
| "aws-sdk-basic@0.10.0": | |
| 448, | |
| "aws-sdk-basic@0.11.0": | |
| 441, | |
| "aws-sdk-basic@0.12.1": | |
| 542, | |
| "aws-sdk-basic@0.13.0": | |
| 435, | |
| "aws-sdk-basic@0.14.0": | |
| 414, | |
| "aws-sdk-basic@0.14.1": | |
| 431, | |
| "aws-sdk-basic@0.15.0": | |
| 868, | |
| "aws-sdk-basic@0.15.1": | |
| 871, | |
| "aws-sdk-basic@0.15.2": | |
| -474, | |
| "aws-sdk-basic@0.16.0": | |
| -585, | |
| "aws-sdk-basic@0.16.1": | |
| -452, | |
| "aws-sdk-basic@0.16.2": | |
| -462, | |
| "aws-serverlessapplicationrepository@0.0.1": | |
| 574, | |
| "aws-serverlessapplicationrepository@0.1.1": | |
| 572, | |
| "aws-serverlessapplicationrepository@0.1.2": | |
| 567, | |
| "aws-serverlessapplicationrepository@0.2.1": | |
| 669, | |
| "aws-serverlessapplicationrepository@0.3.1": | |
| 539, | |
| "aws-servicecatalog@0.0.1": | |
| 561, | |
| "aws-servicecatalog@0.1.1": | |
| 563, | |
| "aws-servicecatalog@0.1.2": | |
| 563, | |
| "aws-servicecatalog@0.2.1": | |
| 687, | |
| "aws-servicecatalog@0.3.1": | |
| 537, | |
| "aws-servicediscovery@0.0.1": | |
| 552, | |
| "aws-servicediscovery@0.1.1": | |
| 572, | |
| "aws-servicediscovery@0.1.2": | |
| 562, | |
| "aws-servicediscovery@0.2.1": | |
| 567, | |
| "aws-servicediscovery@0.3.1": | |
| 689, | |
| "aws-ses@0.0.1": | |
| 546, | |
| "aws-ses@0.1.1": | |
| 551, | |
| "aws-ses@0.1.2": | |
| 561, | |
| "aws-ses@0.2.1": | |
| 564, | |
| "aws-ses@0.3.1": | |
| 554, | |
| "aws-shield@0.0.1": | |
| 682, | |
| "aws-shield@0.1.1": | |
| 555, | |
| "aws-shield@0.1.2": | |
| 549, | |
| "aws-shield@0.2.1": | |
| 559, | |
| "aws-shield@0.3.1": | |
| 553, | |
| "aws-simpledb@0.0.1": | |
| 565, | |
| "aws-simpledb@0.1.1": | |
| 573, | |
| "aws-simpledb@0.1.2": | |
| 681, | |
| "aws-simpledb@0.2.1": | |
| 551, | |
| "aws-simpledb@0.3.1": | |
| 544, | |
| "aws-sms@0.0.1": | |
| 561, | |
| "aws-sms@0.1.1": | |
| 568, | |
| "aws-sms@0.1.2": | |
| 562, | |
| "aws-sms@0.2.1": | |
| 566, | |
| "aws-sms@0.3.1": | |
| 677, | |
| "aws-snowball@0.0.1": | |
| 551, | |
| "aws-snowball@0.1.1": | |
| 543, | |
| "aws-snowball@0.1.2": | |
| 562, | |
| "aws-snowball@0.2.1": | |
| 582, | |
| "aws-snowball@0.3.1": | |
| 557, | |
| "aws-sns@0.0.1": | |
| 579, | |
| "aws-sns@0.1.1": | |
| 688, | |
| "aws-sns@0.1.2": | |
| 556, | |
| "aws-sns@0.2.1": | |
| 551, | |
| "aws-sns@0.3.1": | |
| 558, | |
| "aws-sqs@0.0.1": | |
| 565, | |
| "aws-sqs@0.1.1": | |
| 568, | |
| "aws-sqs@0.1.2": | |
| 574, | |
| "aws-sqs@0.2.1": | |
| 687, | |
| "aws-sqs@0.3.1": | |
| 541, | |
| "aws-ssm@0.0.1": | |
| 547, | |
| "aws-ssm@0.1.1": | |
| 559, | |
| "aws-ssm@0.1.2": | |
| 565, | |
| "aws-ssm@0.2.1": | |
| 567, | |
| "aws-ssm@0.3.1": | |
| 554, | |
| "aws-stepfunctions@0.0.1": | |
| 684, | |
| "aws-stepfunctions@0.1.1": | |
| 547, | |
| "aws-stepfunctions@0.1.2": | |
| 543, | |
| "aws-stepfunctions@0.2.1": | |
| 561, | |
| "aws-stepfunctions@0.3.1": | |
| 552, | |
| "aws-storagegateway@0.0.1": | |
| 564, | |
| "aws-storagegateway@0.1.1": | |
| 569, | |
| "aws-storagegateway@0.1.2": | |
| 699, | |
| "aws-storagegateway@0.2.1": | |
| 561, | |
| "aws-storagegateway@0.3.1": | |
| 532, | |
| "aws-sts@0.0.1": | |
| 559, | |
| "aws-sts@0.1.1": | |
| 568, | |
| "aws-sts@0.1.2": | |
| 564, | |
| "aws-sts@0.2.1": | |
| 566, | |
| "aws-sts@0.3.1": | |
| 680, | |
| "aws-support@0.0.1": | |
| 603, | |
| "aws-support@0.1.1": | |
| 546, | |
| "aws-support@0.1.2": | |
| 565, | |
| "aws-support@0.2.1": | |
| 567, | |
| "aws-support@0.3.1": | |
| 555, | |
| "aws-swf@0.0.1": | |
| 567, | |
| "aws-swf@0.1.1": | |
| 665, | |
| "aws-swf@0.1.2": | |
| 554, | |
| "aws-swf@0.2.1": | |
| 554, | |
| "aws-swf@0.3.1": | |
| 551, | |
| "aws-transcribeservice@0.0.1": | |
| 562, | |
| "aws-transcribeservice@0.1.1": | |
| 565, | |
| "aws-transcribeservice@0.1.2": | |
| 566, | |
| "aws-transcribeservice@0.2.1": | |
| 681, | |
| "aws-transcribeservice@0.3.1": | |
| 543, | |
| "aws-translate@0.0.1": | |
| 542, | |
| "aws-translate@0.1.1": | |
| 560, | |
| "aws-translate@0.1.2": | |
| 561, | |
| "aws-translate@0.2.1": | |
| 564, | |
| "aws-translate@0.3.1": | |
| 556, | |
| "aws-waf@0.0.1": | |
| 680, | |
| "aws-waf@0.1.1": | |
| 557, | |
| "aws-waf@0.1.2": | |
| 552, | |
| "aws-waf@0.2.1": | |
| 585, | |
| "aws-waf@0.3.1": | |
| 554, | |
| "aws-wafregional@0.0.1": | |
| 575, | |
| "aws-wafregional@0.1.1": | |
| 568, | |
| "aws-wafregional@0.1.2": | |
| 683, | |
| "aws-wafregional@0.2.1": | |
| 550, | |
| "aws-wafregional@0.3.1": | |
| 537, | |
| "aws-workdocs@0.0.1": | |
| 562, | |
| "aws-workdocs@0.1.1": | |
| 560, | |
| "aws-workdocs@0.1.2": | |
| 567, | |
| "aws-workdocs@0.2.1": | |
| 566, | |
| "aws-workdocs@0.3.1": | |
| 669, | |
| "aws-workmail@0.0.1": | |
| 551, | |
| "aws-workmail@0.1.1": | |
| 544, | |
| "aws-workmail@0.1.2": | |
| 557, | |
| "aws-workmail@0.2.1": | |
| 568, | |
| "aws-workmail@0.3.1": | |
| 556, | |
| "aws-workspaces@0.0.1": | |
| 563, | |
| "aws-workspaces@0.1.1": | |
| 680, | |
| "aws-workspaces@0.1.2": | |
| 554, | |
| "aws-workspaces@0.2.1": | |
| 543, | |
| "aws-workspaces@0.3.1": | |
| 549, | |
| "aws-xray@0.0.1": | |
| 566, | |
| "aws-xray@0.1.1": | |
| 568, | |
| "aws-xray@0.1.2": | |
| 566, | |
| "aws-xray@0.2.1": | |
| 684, | |
| "aws-xray@0.3.1": | |
| 546, | |
| "axios@0.0.1": | |
| 375, | |
| "axios@1.0.2": | |
| 388, | |
| "axios@1.1.0": | |
| 396, | |
| "axios@1.1.1": | |
| 398, | |
| "axios@1.1.2": | |
| 397, | |
| "b64@0.0.1": | |
| 78, | |
| "b64@0.0.2": | |
| 187, | |
| "b64@0.0.3": | |
| 168, | |
| "b64@0.0.4": | |
| 155, | |
| "b64@0.0.5": | |
| 105, | |
| "b64@0.0.6": | |
| 102, | |
| "b64@0.0.7": | |
| 102, | |
| "b64@0.0.8": | |
| 167, | |
| "barbies@1.0.0": | |
| 66, | |
| "barbies@1.0.1": | |
| 78, | |
| "barlow-lens@0.1.0": | |
| -205, | |
| "barlow-lens@0.1.1": | |
| -195, | |
| "barlow-lens@0.2.0": | |
| -193, | |
| "barlow-lens@0.3.0": | |
| 205, | |
| "barlow-lens@0.4.0": | |
| 139, | |
| "barlow-lens@0.5.0": | |
| 97, | |
| "barlow-lens@0.6.0": | |
| 204, | |
| "barlow-lens@0.7.0": | |
| 111, | |
| "barlow-lens@0.7.1": | |
| 108, | |
| "barlow-lens@0.7.2": | |
| 114, | |
| "barlow-lens@0.8.0": | |
| 108, | |
| "barlow-lens@0.9.0": | |
| 200, | |
| "base@0.1.0": | |
| 60, | |
| "base@0.2.0": | |
| 58, | |
| "base@0.2.1": | |
| 76, | |
| "base@1.0.0": | |
| 75, | |
| "base-rationals@0.1.0": | |
| 160, | |
| "base-rationals@0.1.1": | |
| 148, | |
| "base-rationals@0.1.2": | |
| 144, | |
| "base58@0.0.3": | |
| 145, | |
| "base64-2@0.0.0": | |
| 45, | |
| "base64-2@0.0.1": | |
| 50, | |
| "base64-2@0.0.2": | |
| 79, | |
| "base64-2@1.0.0": | |
| 68, | |
| "base64-2@1.0.1": | |
| 75, | |
| "base64-2@2.0.0": | |
| 76, | |
| "base64-2@2.0.1": | |
| 112, | |
| "base64-codec@0.9.1": | |
| 747, | |
| "base64-codec@0.9.2": | |
| 2381, | |
| "base64-codec@0.10.0": | |
| 56, | |
| "base64-codec@0.10.1": | |
| 136, | |
| "base64-codec@0.10.2": | |
| 48, | |
| "base64-codec@0.10.3": | |
| 53, | |
| "base64-codec@0.11.0": | |
| 61, | |
| "base64-codec@1.0.0": | |
| 68, | |
| "basic-auth@0.0.1": | |
| 336, | |
| "basic-auth@1.0.0": | |
| 286, | |
| "basic-auth@1.0.1": | |
| 284, | |
| "basic-auth@1.0.2": | |
| 377, | |
| "basic-auth@1.0.3": | |
| 285, | |
| "basic-auth@2.0.0": | |
| 177, | |
| "basic-auth@2.1.0": | |
| 181, | |
| "basic-auth@3.0.0": | |
| 147, | |
| "basic-auth@3.0.1": | |
| 137, | |
| "batteries@0.1.0": | |
| 171, | |
| "batteries@0.2.0": | |
| 80, | |
| "batteries@0.2.1": | |
| 77, | |
| "batteries@0.2.4": | |
| 91, | |
| "batteries@0.2.5": | |
| 99, | |
| "batteries@0.3.0": | |
| 97, | |
| "batteries@0.4.0": | |
| 170, | |
| "batteries@0.5.0": | |
| 91, | |
| "batteries@0.5.1": | |
| 70, | |
| "batteries@0.5.2": | |
| 75, | |
| "batteries@0.5.3": | |
| 89, | |
| "batteries@0.5.4": | |
| -84, | |
| "batteries@0.6.0": | |
| -80, | |
| "batteries@0.7.0": | |
| -242, | |
| "batteries-core@0.0.2": | |
| 549, | |
| "batteries-core@0.0.3": | |
| 432, | |
| "batteries-core@0.0.5": | |
| 428, | |
| "batteries-core@0.0.6": | |
| 448, | |
| "batteries-core@0.2.0": | |
| 151, | |
| "bbcode-parser@0.1.0": | |
| -158, | |
| "behaviors@0.1.0": | |
| 64, | |
| "behaviors@1.0.0": | |
| 74, | |
| "behaviors@1.0.1": | |
| 136, | |
| "behaviors@1.0.2": | |
| 74, | |
| "behaviors@2.0.0": | |
| 58, | |
| "behaviors@3.0.0": | |
| 75, | |
| "behaviors@4.0.0": | |
| 622, | |
| "behaviors@5.0.0": | |
| 570, | |
| "behaviors@5.1.0": | |
| 697, | |
| "behaviors@5.2.0": | |
| 543, | |
| "behaviors@6.0.0": | |
| 217, | |
| "behaviors@6.0.1": | |
| 232, | |
| "behaviors@6.1.0": | |
| 235, | |
| "behaviors@6.2.0": | |
| 236, | |
| "behaviors@6.3.0": | |
| 236, | |
| "behaviors@7.0.0": | |
| 382, | |
| "behaviors@8.0.0": | |
| 240, | |
| "bench@0.0.1": | |
| 43, | |
| "bench@0.0.2": | |
| 59, | |
| "bench@0.0.3": | |
| 68, | |
| "bench@1.0.0": | |
| 67, | |
| "benchmark@0.1.0": | |
| 189, | |
| "benchotron@3.0.5": | |
| 213, | |
| "benchotron@4.0.0": | |
| 80, | |
| "benchotron@5.0.0": | |
| 534, | |
| "benchotron@6.0.0": | |
| 534, | |
| "benchotron@7.0.0": | |
| 352, | |
| "benchotron@7.0.1": | |
| 347, | |
| "bf-gun@0.0.32": | |
| 259, | |
| "bf-gun@0.0.33": | |
| 343, | |
| "bf-gun@0.0.34": | |
| 245, | |
| "bf-gun@0.0.35": | |
| 245, | |
| "bf-gun@0.0.36": | |
| 255, | |
| "bf-gun@0.1.0": | |
| 255, | |
| "bf-gun@0.2.0": | |
| 361, | |
| "bibimbap@0.1.0": | |
| 84, | |
| "bifunctors@0.0.1": | |
| -41, | |
| "bifunctors@0.0.2": | |
| -75, | |
| "bifunctors@0.0.3": | |
| -71, | |
| "bifunctors@0.0.4": | |
| 69, | |
| "bifunctors@0.0.5": | |
| 68, | |
| "bifunctors@0.0.6": | |
| 76, | |
| "bifunctors@0.1.0": | |
| 127, | |
| "bifunctors@0.2.0": | |
| 56, | |
| "bifunctors@0.3.0": | |
| 71, | |
| "bifunctors@0.3.1": | |
| 76, | |
| "bifunctors@0.4.0": | |
| 59, | |
| "bifunctors@1.0.0": | |
| 132, | |
| "bifunctors@2.0.0": | |
| 50, | |
| "bifunctors@3.0.0": | |
| 51, | |
| "bifunctors@4.0.0": | |
| 55, | |
| "bifunctors@5.0.0": | |
| 80, | |
| "bifunctors@6.0.0": | |
| 73, | |
| "bigints@0.2.2": | |
| 73, | |
| "bigints@1.0.0": | |
| 73, | |
| "bigints@1.0.1": | |
| 131, | |
| "bigints@2.0.0": | |
| 63, | |
| "bigints@3.0.0": | |
| 70, | |
| "bigints@3.1.0": | |
| 65, | |
| "bigints@3.2.0": | |
| 607, | |
| "bigints@3.3.0": | |
| 66, | |
| "bigints@3.4.0": | |
| 68, | |
| "bigints@3.5.0": | |
| 144, | |
| "bigints@4.0.0": | |
| 206, | |
| "bigints@5.0.0": | |
| 2105, | |
| "bigints@6.0.0": | |
| 79, | |
| "bigints@7.0.0": | |
| 86, | |
| "bigints@7.0.1": | |
| 89, | |
| "bignumber@1.0.0": | |
| 103, | |
| "bignumber@1.0.1": | |
| 215, | |
| "binary@0.0.1": | |
| 107, | |
| "binary@0.0.2": | |
| 96, | |
| "binary@0.0.3": | |
| 107, | |
| "binary@0.0.4": | |
| 112, | |
| "binary@0.0.5": | |
| 114, | |
| "binary@0.0.6": | |
| 112, | |
| "binary@0.0.7": | |
| 115, | |
| "binary@0.0.8": | |
| 225, | |
| "binary@0.0.9": | |
| 96, | |
| "binary@0.0.10": | |
| 97, | |
| "binary@0.0.11": | |
| 107, | |
| "binary@0.0.12": | |
| 112, | |
| "binary@0.0.13": | |
| 110, | |
| "binary@0.0.14": | |
| 112, | |
| "binary@0.0.15": | |
| 193, | |
| "binary@0.0.16": | |
| 100, | |
| "binary@0.0.17": | |
| 93, | |
| "binary@0.0.18": | |
| 107, | |
| "binary@0.0.19": | |
| 116, | |
| "binary@0.0.20": | |
| 111, | |
| "binary@0.0.21": | |
| 111, | |
| "binary@0.1.0": | |
| 115, | |
| "binary@0.1.1": | |
| 188, | |
| "binary@0.2.0": | |
| 151, | |
| "binary@0.2.1": | |
| 127, | |
| "binary@0.2.2": | |
| 127, | |
| "binary@0.2.3": | |
| 141, | |
| "binary@0.2.4": | |
| 141, | |
| "binary@0.2.5": | |
| 139, | |
| "binary@0.2.6": | |
| 142, | |
| "binary@0.2.7": | |
| 255, | |
| "binary@0.2.8": | |
| 128, | |
| "binary@0.2.9": | |
| 124, | |
| "binary-integers@0.0.1": | |
| 112, | |
| "binary-integers@0.0.2": | |
| 122, | |
| "binary-integers@0.0.3": | |
| 122, | |
| "bingsu@0.1.0": | |
| 324, | |
| "bingsu@0.2.0": | |
| 321, | |
| "bip39@0.0.1": | |
| 125, | |
| "bip39@0.0.2": | |
| 77, | |
| "bip39@1.0.0": | |
| 47, | |
| "bip39@1.0.1": | |
| 63, | |
| "birds@1.0.0": | |
| 183, | |
| "birds@1.0.1": | |
| 168, | |
| "birds@1.0.2": | |
| 161, | |
| "birds@1.0.3": | |
| 240, | |
| "birds@1.0.4": | |
| 145, | |
| "biscotti-cookie@0.1.0": | |
| 313, | |
| "biscotti-cookie@0.2.0": | |
| 335, | |
| "biscotti-cookie@0.3.0": | |
| 153, | |
| "biscotti-session@0.1.0": | |
| 507, | |
| "biscotti-session@0.1.1": | |
| 598, | |
| "biscotti-session@0.1.2": | |
| 400, | |
| "biscotti-session@0.2.0": | |
| 196, | |
| "bismuth@0.1.0": | |
| 173, | |
| "bismuth@0.2.0": | |
| 171, | |
| "bismuth@0.3.0": | |
| 172, | |
| "bismuth@0.3.1": | |
| 264, | |
| "black-scholes@0.1.0": | |
| 39, | |
| "black-scholes@0.1.1": | |
| 54, | |
| "bolson@0.0.0": | |
| -134, | |
| "bolson@0.0.1": | |
| -135, | |
| "bolson@0.0.2": | |
| -137, | |
| "bolson@0.0.3": | |
| -217, | |
| "bolson@0.0.4": | |
| -118, | |
| "bolson@0.0.5": | |
| -127, | |
| "bolson@0.0.6": | |
| 187, | |
| "bolson@0.0.7": | |
| -123, | |
| "bolson@0.0.8": | |
| -126, | |
| "bolson@0.0.9": | |
| 220, | |
| "bolson@0.1.0": | |
| 119, | |
| "bolson@0.1.1": | |
| 124, | |
| "bolson@0.3.1": | |
| 111, | |
| "bonjiri@0.1.0": | |
| 185, | |
| "bonjiri@0.2.0": | |
| 183, | |
| "bonjiri@0.3.0": | |
| 185, | |
| "bonjiri@0.4.0": | |
| 182, | |
| "bonjiri@0.5.0": | |
| 305, | |
| "bonjiri@0.6.0": | |
| 167, | |
| "bonjiri@0.7.0": | |
| 164, | |
| "bonsai@0.1.0": | |
| 358, | |
| "bonsai@0.2.0": | |
| 388, | |
| "bonsai@0.3.0": | |
| 387, | |
| "bonsai@0.4.0": | |
| 371, | |
| "bonsai@0.5.0": | |
| 451, | |
| "bonsai@0.6.0": | |
| 300, | |
| "boolean-eq@0.1.0": | |
| 43, | |
| "boolean-eq@0.1.1": | |
| 62, | |
| "boolean-eq@0.2.0": | |
| 77, | |
| "boolean-eq@0.3.0": | |
| 77, | |
| "boomboom@0.1.0": | |
| 175, | |
| "boomboom@0.1.1": | |
| 170, | |
| "boomboom@0.2.0": | |
| 280, | |
| "boomboom@0.2.1": | |
| 150, | |
| "boomboom@0.2.3": | |
| 155, | |
| "boomboom@0.2.6": | |
| 181, | |
| "boomboom@0.2.8": | |
| 163, | |
| "boomboom@0.2.10": | |
| 168, | |
| "boomboom@0.4.0": | |
| 163, | |
| "boomboom@0.4.1": | |
| 287, | |
| "boomboom@0.4.2": | |
| 153, | |
| "boomboom@0.4.3": | |
| 148, | |
| "boomboom@0.4.4": | |
| 157, | |
| "boomboom@0.4.5": | |
| 165, | |
| "boomerang@0.0.2": | |
| 79, | |
| "boomerang@0.0.3": | |
| 82, | |
| "boomerang@0.0.4": | |
| 84, | |
| "boomerang@0.0.5": | |
| 184, | |
| "boomerang@0.0.6": | |
| 74, | |
| "boomerang@0.0.7": | |
| 64, | |
| "boomerang@0.0.8": | |
| 84, | |
| "boomerang@0.0.9": | |
| 89, | |
| "boomerang@0.0.10": | |
| 85, | |
| "boomerang@0.0.11": | |
| 88, | |
| "boomerang@0.0.12": | |
| 185, | |
| "boomerang@0.0.13": | |
| 81, | |
| "boomerang@0.0.14": | |
| 80, | |
| "boomerang@1.0.0": | |
| 72, | |
| "boomerang@1.0.1": | |
| 75, | |
| "boomerang@1.1.0": | |
| 75, | |
| "boomerang@1.1.1": | |
| 79, | |
| "boomerang@1.2.0": | |
| 434, | |
| "boomerang@1.2.1": | |
| 256, | |
| "boomerang@1.3.0": | |
| -333, | |
| "boomerang@1.4.0": | |
| 203, | |
| "boomerang@1.5.0": | |
| 202, | |
| "boomerang@1.5.1": | |
| 202, | |
| "boomerang@1.6.0": | |
| 292, | |
| "boomerang@1.7.0": | |
| 200, | |
| "boomerang@1.8.0": | |
| 200, | |
| "boomerang@1.8.1": | |
| 209, | |
| "bound@0.1.0": | |
| 128, | |
| "bound@0.2.0": | |
| 204, | |
| "bound@0.3.0": | |
| 125, | |
| "bound@0.4.0": | |
| 111, | |
| "bound@0.5.0": | |
| 232, | |
| "bouzuya-http-method@0.1.0": | |
| 65, | |
| "bouzuya-http-method@0.2.0": | |
| 75, | |
| "bouzuya-http-method@0.2.1": | |
| 63, | |
| "bouzuya-http-status-code@0.1.0": | |
| 71, | |
| "bower-json@0.0.1": | |
| 259, | |
| "bower-json@0.1.0": | |
| 182, | |
| "bower-json@1.0.0": | |
| 171, | |
| "bower-json@2.0.0": | |
| 151, | |
| "bower-json@3.0.0": | |
| 114, | |
| "boxes@1.0.0": | |
| 142, | |
| "boxes@1.0.1": | |
| 145, | |
| "boxes@1.0.2": | |
| 142, | |
| "boxes@2.0.0": | |
| 269, | |
| "boxes@2.0.1": | |
| 139, | |
| "boxes@2.0.2": | |
| 86, | |
| "boxes@2.1.0": | |
| 87, | |
| "bq@0.1.0": | |
| 252, | |
| "bq@0.1.1": | |
| 238, | |
| "bq@0.1.2": | |
| 239, | |
| "bq@0.1.3": | |
| 237, | |
| "bq@0.1.4": | |
| 323, | |
| "bq@0.1.5": | |
| 225, | |
| "browser-cookies@0.0.1": | |
| 199, | |
| "browser-sniffer@0.0.0": | |
| 59, | |
| "browserfeatures@0.1.0": | |
| 91, | |
| "browserfeatures@0.2.0": | |
| 161, | |
| "browserfeatures@0.2.1": | |
| -79, | |
| "browserfeatures@0.2.2": | |
| -78, | |
| "browserfeatures@0.3.0": | |
| 77, | |
| "browserfeatures@0.4.0": | |
| 106, | |
| "browserfeatures@0.4.1": | |
| 103, | |
| "browserfeatures@0.4.2": | |
| 104, | |
| "browserfeatures@1.0.0": | |
| 175, | |
| "browserfeatures@2.0.0": | |
| -207, | |
| "browserfeatures@3.0.0": | |
| 440, | |
| "browserfeatures@4.0.0": | |
| 693, | |
| "browserfeatures@5.0.0": | |
| 689, | |
| "bucketchain@0.1.0": | |
| 279, | |
| "bucketchain@0.1.1": | |
| 363, | |
| "bucketchain@0.1.2": | |
| 342, | |
| "bucketchain@0.2.0": | |
| 263, | |
| "bucketchain@0.2.1": | |
| 355, | |
| "bucketchain@0.2.2": | |
| 268, | |
| "bucketchain@0.2.3": | |
| 269, | |
| "bucketchain@0.2.4": | |
| 291, | |
| "bucketchain@0.2.5": | |
| 293, | |
| "bucketchain@0.2.6": | |
| 285, | |
| "bucketchain@0.2.7": | |
| 280, | |
| "bucketchain@0.2.8": | |
| 286, | |
| "bucketchain@0.2.9": | |
| 395, | |
| "bucketchain@0.2.10": | |
| 267, | |
| "bucketchain@0.2.11": | |
| 266, | |
| "bucketchain@0.2.12": | |
| 300, | |
| "bucketchain@0.3.0": | |
| 281, | |
| "bucketchain@0.4.0": | |
| 166, | |
| "bucketchain@1.0.0": | |
| 270, | |
| "bucketchain@1.0.1": | |
| 127, | |
| "bucketchain-basic-auth@0.1.0": | |
| 516, | |
| "bucketchain-basic-auth@0.2.0": | |
| 476, | |
| "bucketchain-basic-auth@0.3.0": | |
| 220, | |
| "bucketchain-basic-auth@1.0.0": | |
| 188, | |
| "bucketchain-basic-auth@1.0.1": | |
| 155, | |
| "bucketchain-conditional@0.1.0": | |
| 547, | |
| "bucketchain-conditional@0.2.0": | |
| 622, | |
| "bucketchain-conditional@0.3.0": | |
| 183, | |
| "bucketchain-conditional@1.0.0": | |
| 146, | |
| "bucketchain-conditional@1.0.1": | |
| 138, | |
| "bucketchain-cors@0.1.0": | |
| 488, | |
| "bucketchain-cors@0.2.0": | |
| 598, | |
| "bucketchain-cors@0.3.0": | |
| 469, | |
| "bucketchain-cors@0.4.0": | |
| 200, | |
| "bucketchain-cors@1.0.0": | |
| 173, | |
| "bucketchain-cors@1.0.1": | |
| 186, | |
| "bucketchain-csrf@0.1.0": | |
| 523, | |
| "bucketchain-csrf@0.2.0": | |
| 476, | |
| "bucketchain-csrf@0.3.0": | |
| 214, | |
| "bucketchain-csrf@1.0.0": | |
| 270, | |
| "bucketchain-csrf@1.0.1": | |
| 131, | |
| "bucketchain-header-utils@0.1.0": | |
| 481, | |
| "bucketchain-header-utils@0.2.0": | |
| 468, | |
| "bucketchain-header-utils@0.3.0": | |
| 469, | |
| "bucketchain-header-utils@0.4.0": | |
| 299, | |
| "bucketchain-header-utils@1.0.0": | |
| 164, | |
| "bucketchain-header-utils@1.0.1": | |
| 129, | |
| "bucketchain-health@0.1.0": | |
| 499, | |
| "bucketchain-health@0.2.0": | |
| 471, | |
| "bucketchain-health@0.3.0": | |
| 210, | |
| "bucketchain-health@1.0.0": | |
| 178, | |
| "bucketchain-health@1.0.1": | |
| 145, | |
| "bucketchain-history-api-fallback@0.1.0": | |
| 617, | |
| "bucketchain-history-api-fallback@0.2.0": | |
| 463, | |
| "bucketchain-history-api-fallback@0.3.0": | |
| 453, | |
| "bucketchain-history-api-fallback@0.4.0": | |
| 210, | |
| "bucketchain-history-api-fallback@1.0.0": | |
| 177, | |
| "bucketchain-history-api-fallback@1.0.1": | |
| 145, | |
| "bucketchain-logger@0.1.0": | |
| 628, | |
| "bucketchain-logger@0.1.1": | |
| 468, | |
| "bucketchain-logger@0.2.0": | |
| 450, | |
| "bucketchain-logger@0.3.0": | |
| 417, | |
| "bucketchain-logger@0.4.0": | |
| 189, | |
| "bucketchain-logger@1.0.0": | |
| 154, | |
| "bucketchain-logger@1.0.1": | |
| 133, | |
| "bucketchain-secure@0.1.0": | |
| 613, | |
| "bucketchain-secure@0.2.0": | |
| 211, | |
| "bucketchain-secure@1.0.0": | |
| 155, | |
| "bucketchain-secure@1.0.1": | |
| 137, | |
| "bucketchain-simple-api@0.1.0": | |
| 502, | |
| "bucketchain-simple-api@0.1.1": | |
| 496, | |
| "bucketchain-simple-api@0.1.2": | |
| 492, | |
| "bucketchain-simple-api@0.1.3": | |
| 597, | |
| "bucketchain-simple-api@0.2.0": | |
| 476, | |
| "bucketchain-simple-api@0.3.0": | |
| 450, | |
| "bucketchain-simple-api@0.4.0": | |
| 423, | |
| "bucketchain-simple-api@0.4.1": | |
| 415, | |
| "bucketchain-simple-api@0.4.2": | |
| 378, | |
| "bucketchain-simple-api@0.5.0": | |
| 346, | |
| "bucketchain-simple-api@0.5.1": | |
| 446, | |
| "bucketchain-simple-api@1.0.0": | |
| 339, | |
| "bucketchain-simple-api@2.0.0": | |
| 330, | |
| "bucketchain-simple-api@2.1.0": | |
| 333, | |
| "bucketchain-simple-api@3.0.0": | |
| 349, | |
| "bucketchain-simple-api@4.0.0": | |
| 211, | |
| "bucketchain-simple-api@5.0.0": | |
| 164, | |
| "bucketchain-simple-api@5.0.1": | |
| 164, | |
| "bucketchain-sslify@0.1.0": | |
| 612, | |
| "bucketchain-sslify@0.1.1": | |
| 490, | |
| "bucketchain-sslify@0.2.0": | |
| 449, | |
| "bucketchain-sslify@0.3.0": | |
| 208, | |
| "bucketchain-sslify@1.0.0": | |
| 171, | |
| "bucketchain-sslify@1.0.1": | |
| 142, | |
| "bucketchain-static@0.1.0": | |
| 660, | |
| "bucketchain-static@0.2.0": | |
| 497, | |
| "bucketchain-static@0.3.0": | |
| 494, | |
| "bucketchain-static@0.4.0": | |
| 198, | |
| "bucketchain-static@1.0.0": | |
| 167, | |
| "bucketchain-static@1.0.1": | |
| 138, | |
| "bulma@1.0.0": | |
| 63, | |
| "bulma@1.0.1": | |
| 124, | |
| "bulma@1.1.0": | |
| 48, | |
| "bulma@2.0.0": | |
| 120, | |
| "byte-codec@0.0.0": | |
| 129, | |
| "byte-codec@0.0.1": | |
| 461, | |
| "bytestrings@0.0.1": | |
| 69, | |
| "bytestrings@0.0.2": | |
| 70, | |
| "bytestrings@0.0.3": | |
| 256, | |
| "bytestrings@1.0.0": | |
| 147, | |
| "bytestrings@1.0.1": | |
| 145, | |
| "bytestrings@1.1.0": | |
| 153, | |
| "bytestrings@1.2.0": | |
| 159, | |
| "bytestrings@2.0.0": | |
| 163, | |
| "bytestrings@2.1.0": | |
| 160, | |
| "bytestrings@2.2.0": | |
| 247, | |
| "bytestrings@2.3.0": | |
| 149, | |
| "bytestrings@3.0.0": | |
| 262, | |
| "bytestrings@3.0.1": | |
| 276, | |
| "bytestrings@4.0.0": | |
| 331, | |
| "bytestrings@4.0.1": | |
| 420, | |
| "bytestrings@5.0.0": | |
| 319, | |
| "bytestrings@5.0.1": | |
| 319, | |
| "bytestrings@5.0.2": | |
| 322, | |
| "bytestrings@6.0.0": | |
| 321, | |
| "bytestrings@7.0.0": | |
| 179, | |
| "bytestrings@8.0.0": | |
| 183, | |
| "c3@0.1.0": | |
| 55, | |
| "c3@0.1.1": | |
| 137, | |
| "call-by-name@1.0.0": | |
| 64, | |
| "call-by-name@2.0.0": | |
| 66, | |
| "call-by-name@3.0.0": | |
| 94, | |
| "call-by-name@4.0.0": | |
| 78, | |
| "call-by-name@4.0.1": | |
| 76, | |
| "calpis@0.1.0": | |
| 272, | |
| "calpis@0.2.0": | |
| 166, | |
| "camanjs@0.0.1": | |
| 166, | |
| "camanjs@0.0.2": | |
| 170, | |
| "camanjs@0.0.3": | |
| 186, | |
| "camanjs@0.0.4": | |
| 185, | |
| "camanjs@0.0.5": | |
| 188, | |
| "camanjs@0.0.6": | |
| 188, | |
| "canvas@0.1.0": | |
| 114, | |
| "canvas@0.1.1": | |
| 58, | |
| "canvas@0.1.2": | |
| 45, | |
| "canvas@0.1.3": | |
| 55, | |
| "canvas@0.1.4": | |
| 71, | |
| "canvas@0.1.5": | |
| 66, | |
| "canvas@0.1.6": | |
| 69, | |
| "canvas@0.2.0": | |
| 67, | |
| "canvas@0.3.0": | |
| 115, | |
| "canvas@0.3.1": | |
| 50, | |
| "canvas@0.3.2": | |
| 54, | |
| "canvas@0.3.3": | |
| 66, | |
| "canvas@0.3.4": | |
| 89, | |
| "canvas@0.3.5": | |
| 67, | |
| "canvas@0.4.0": | |
| 123, | |
| "canvas@0.5.0": | |
| 54, | |
| "canvas@0.5.1": | |
| 55, | |
| "canvas@0.5.2": | |
| 81, | |
| "canvas@0.5.3": | |
| 70, | |
| "canvas@0.5.4": | |
| 140, | |
| "canvas@1.0.0": | |
| 50, | |
| "canvas@2.0.0": | |
| 78, | |
| "canvas@3.0.0": | |
| 75, | |
| "canvas@3.1.0": | |
| 87, | |
| "canvas@3.2.0": | |
| 77, | |
| "canvas@3.3.0": | |
| 79, | |
| "canvas@4.0.0": | |
| 140, | |
| "canvas@5.0.0": | |
| 55, | |
| "canvas@6.0.0": | |
| 54, | |
| "canvas-action@1.0.0": | |
| 245, | |
| "canvas-action@1.0.1": | |
| 223, | |
| "canvas-action@1.0.2": | |
| 220, | |
| "canvas-action@2.0.0": | |
| 202, | |
| "canvas-action@2.0.1": | |
| 292, | |
| "canvas-action@3.0.0": | |
| 266, | |
| "canvas-action@3.0.1": | |
| 252, | |
| "canvas-action@3.0.3": | |
| 273, | |
| "canvas-action@3.0.4": | |
| 272, | |
| "canvas-action@4.0.0": | |
| 275, | |
| "canvas-action@4.0.1": | |
| 361, | |
| "canvas-action@5.0.0": | |
| 245, | |
| "canvas-action@5.0.1": | |
| 253, | |
| "canvas-action@6.0.1": | |
| 254, | |
| "canvas-action@7.0.0": | |
| 128, | |
| "canvas-action@8.0.0": | |
| 125, | |
| "canvas-action@9.0.0": | |
| 197, | |
| "canvas-geometry@1.0.0": | |
| 281, | |
| "canvas-geometry@1.0.1": | |
| 250, | |
| "canvas-geometry@1.0.2": | |
| 257, | |
| "canvas-geometry@2.0.0": | |
| 266, | |
| "carpenter@1.0.0": | |
| 73, | |
| "carpenter@1.1.0": | |
| 75, | |
| "carpenter@1.1.1": | |
| 77, | |
| "carpenter@1.1.2": | |
| 151, | |
| "carpenter@1.2.0": | |
| 107, | |
| "carpenter@2.0.0": | |
| 61, | |
| "carpenter@2.0.1": | |
| 61, | |
| "carpenter@2.1.0": | |
| 83, | |
| "carpenter@2.2.0": | |
| 77, | |
| "carpenter@2.2.1": | |
| 74, | |
| "carpenter@2.3.0": | |
| 77, | |
| "carpenter-router@0.1.0": | |
| -336, | |
| "carpenter-router@0.1.1": | |
| 61, | |
| "carpenter-router@0.1.2": | |
| 70, | |
| "carpenter-router@0.1.3": | |
| 88, | |
| "carpenter-router@1.0.0": | |
| -238, | |
| "cartesian@1.0.1": | |
| 66, | |
| "cartesian@1.0.2": | |
| 100, | |
| "cartesian@1.0.4": | |
| 109, | |
| "cartesian@1.0.5": | |
| 51, | |
| "cartesian@1.0.6": | |
| 50, | |
| "case-insensitive@1.0.0": | |
| 72, | |
| "cast@0.1.0": | |
| 76, | |
| "catenable-lists@0.1.0": | |
| 80, | |
| "catenable-lists@0.1.1": | |
| 83, | |
| "catenable-lists@1.0.0": | |
| 71, | |
| "catenable-lists@1.0.1": | |
| 140, | |
| "catenable-lists@1.1.0": | |
| 63, | |
| "catenable-lists@2.0.0": | |
| 96, | |
| "catenable-lists@3.0.0": | |
| 153, | |
| "catenable-lists@3.0.1": | |
| 137, | |
| "catenable-lists@4.0.0": | |
| 188, | |
| "catenable-lists@5.0.0": | |
| 176, | |
| "catenable-lists@5.0.1": | |
| 99, | |
| "catenable-lists@6.0.0": | |
| 66, | |
| "catenable-lists@6.0.1": | |
| 77, | |
| "catenable-lists@7.0.0": | |
| 78, | |
| "causal-graphs@0.0.1": | |
| 142, | |
| "causal-graphs@0.1.0": | |
| 136, | |
| "causal-graphs@0.2.0": | |
| 139, | |
| "causal-graphs@0.3.0": | |
| 236, | |
| "causal-graphs@0.4.0": | |
| 128, | |
| "causal-graphs@0.4.1": | |
| 118, | |
| "chai@0.0.3": | |
| 44, | |
| "chalk@0.0.1": | |
| 72, | |
| "chalk@0.0.2": | |
| 67, | |
| "chalk@0.0.3": | |
| 66, | |
| "chalk@0.0.4": | |
| 68, | |
| "chalky@0.1.0": | |
| 73, | |
| "chalky@0.2.0": | |
| 122, | |
| "chalky@1.0.0": | |
| 45, | |
| "chalky@2.0.0": | |
| 49, | |
| "channel@0.1.0": | |
| 292, | |
| "channel@0.1.1": | |
| 248, | |
| "channel@0.2.0": | |
| 245, | |
| "channel@1.0.0": | |
| 128, | |
| "channel-stream@0.1.0": | |
| 307, | |
| "channel-stream@1.0.0": | |
| 253, | |
| "chanpon@0.1.0": | |
| 663, | |
| "chanpon@0.2.0": | |
| 626, | |
| "chanpon@1.0.0": | |
| 305, | |
| "chanterelle@0.1.2": | |
| 1077, | |
| "chanterelle@0.2.0": | |
| 1062, | |
| "chanterelle@0.4.0": | |
| 958, | |
| "chanterelle@0.5.0": | |
| 815, | |
| "chanterelle@0.6.0": | |
| 812, | |
| "chanterelle@0.7.0": | |
| -831, | |
| "chanterelle@0.8.0": | |
| -847, | |
| "chanterelle@0.8.1": | |
| -861, | |
| "chanterelle@0.8.2": | |
| -950, | |
| "chanterelle@0.8.3": | |
| -821, | |
| "chanterelle@0.8.4": | |
| -822, | |
| "chanterelle@0.8.5": | |
| -820, | |
| "chanterelle@0.9.0": | |
| 931, | |
| "chanterelle@0.9.1": | |
| 1029, | |
| "chanterelle@0.10.0": | |
| 845, | |
| "chanterelle@0.11.0": | |
| 851, | |
| "chanterelle@0.12.0": | |
| 870, | |
| "chanterelle@0.13.0": | |
| 879, | |
| "chanterelle@4.0.0": | |
| -567, | |
| "chanterelle@4.1.0": | |
| -650, | |
| "chanterelle@5.0.0": | |
| -354, | |
| "chanterelle@5.1.0": | |
| -354, | |
| "chanterelle@5.1.2": | |
| -365, | |
| "chanterelle@5.1.3": | |
| -371, | |
| "chanterelle@6.0.0": | |
| -363, | |
| "chapagetti@0.1.0": | |
| 445, | |
| "chapagetti@1.0.0": | |
| 304, | |
| "charm@0.3.0": | |
| 92, | |
| "charm@0.3.1": | |
| 83, | |
| "charm@0.3.2": | |
| 89, | |
| "charm@0.3.3": | |
| 104, | |
| "charm@0.4.0": | |
| 343, | |
| "charm@0.4.1": | |
| 345, | |
| "chartjs@0.1.0": | |
| 75, | |
| "chartjs@0.2.0": | |
| 132, | |
| "chartjs@0.3.0": | |
| 56, | |
| "chartjs@0.4.0": | |
| 54, | |
| "checked-exceptions@1.0.0": | |
| 211, | |
| "checked-exceptions@2.0.0": | |
| 124, | |
| "checked-exceptions@3.0.0": | |
| 101, | |
| "checked-exceptions@3.1.0": | |
| 99, | |
| "checked-exceptions@3.1.1": | |
| 101, | |
| "cheerio@0.1.0": | |
| 740, | |
| "cheerio@0.2.0": | |
| 408, | |
| "cheerio@0.2.1": | |
| 419, | |
| "cheerio@0.2.2": | |
| 439, | |
| "cheerio@0.2.3": | |
| 441, | |
| "cheerio@0.2.4": | |
| 182, | |
| "cherry@0.1.0": | |
| -425, | |
| "cherry@0.1.1": | |
| -289, | |
| "cherry@0.1.2": | |
| -282, | |
| "cherry@0.1.3": | |
| -296, | |
| "cherry@1.0.0": | |
| 796, | |
| "cherry@1.1.0": | |
| 585, | |
| "cherry@1.1.1": | |
| 642, | |
| "cherry@1.1.2": | |
| 562, | |
| "cherry@2.0.0": | |
| 553, | |
| "cherry@2.0.1": | |
| 569, | |
| "cherry@2.0.2": | |
| 565, | |
| "cherry@2.1.0": | |
| 662, | |
| "cherry@2.2.0": | |
| 556, | |
| "cherry@2.3.0": | |
| 549, | |
| "cherry@2.4.0": | |
| 556, | |
| "cherry@3.0.0": | |
| 270, | |
| "cherry@3.0.1": | |
| 348, | |
| "chirashi@0.1.0": | |
| 102, | |
| "chirashi@1.0.0": | |
| 100, | |
| "choco-pie@0.1.0": | |
| 725, | |
| "choco-pie@0.2.0": | |
| 720, | |
| "choco-pie@0.3.0": | |
| 723, | |
| "choco-pie@1.0.0": | |
| 470, | |
| "choco-pie@2.0.0": | |
| 323, | |
| "choco-pie@3.0.0": | |
| 307, | |
| "choco-pie@4.0.0": | |
| 326, | |
| "choco-pie@5.0.0": | |
| 324, | |
| "choco-pie@6.0.0": | |
| -66, | |
| "chrono@0.1.0": | |
| 131, | |
| "chrono@0.1.1": | |
| 56, | |
| "chrono@0.1.2": | |
| 55, | |
| "cirru-edn@0.0.1": | |
| 190, | |
| "cirru-edn@0.0.3": | |
| 95, | |
| "cirru-edn@0.0.4": | |
| 93, | |
| "cirru-edn@0.0.5": | |
| 99, | |
| "cirru-edn@0.0.6": | |
| 98, | |
| "cirru-edn@0.0.7": | |
| 183, | |
| "cirru-edn@0.0.8": | |
| 77, | |
| "cirru-parser@0.0.2": | |
| 130, | |
| "cirru-parser@0.0.3": | |
| 78, | |
| "cirru-parser@0.0.4": | |
| 91, | |
| "cirru-parser@0.0.5": | |
| 89, | |
| "clappr@0.1.0": | |
| 491, | |
| "clappr@0.2.0": | |
| 362, | |
| "clappr@0.2.1": | |
| 355, | |
| "clappr@0.3.0": | |
| 350, | |
| "clappr@0.4.0": | |
| 365, | |
| "clappr@0.4.1": | |
| 504, | |
| "clappr@0.5.0": | |
| 502, | |
| "clappr@0.6.0": | |
| 513, | |
| "clappr@0.6.1": | |
| 412, | |
| "clappr@0.7.0": | |
| 401, | |
| "clappr@0.7.1": | |
| 413, | |
| "clappr@0.7.2": | |
| 424, | |
| "classless@0.1.0": | |
| 88, | |
| "classless@0.1.1": | |
| 84, | |
| "classless-arbitrary@0.1.1": | |
| 101, | |
| "classless-decode-json@0.1.1": | |
| 207, | |
| "classless-encode-json@0.1.2": | |
| 114, | |
| "classless-encode-json@0.1.3": | |
| 112, | |
| "classnames@0.1.0": | |
| 323, | |
| "classnames@0.1.1": | |
| 105, | |
| "classnames@1.0.0": | |
| 90, | |
| "classnames@2.0.0": | |
| 159, | |
| "clipboard@0.1.0": | |
| -307, | |
| "clipboard@0.2.0": | |
| 705, | |
| "clipboard@0.3.0": | |
| 705, | |
| "clipboard@0.4.0": | |
| 324, | |
| "clipboard@0.5.0": | |
| 427, | |
| "clipboard@1.0.0": | |
| 230, | |
| "clipboardy@1.0.0": | |
| 328, | |
| "clipboardy@1.0.1": | |
| 337, | |
| "clipboardy@1.0.2": | |
| 354, | |
| "clipboardy@1.0.3": | |
| 347, | |
| "clock@0.1.0": | |
| 63, | |
| "clock@0.1.1": | |
| 82, | |
| "clock@1.0.0": | |
| 143, | |
| "clock@1.0.1": | |
| 47, | |
| "clock@2.0.0": | |
| 52, | |
| "cnchar@0.0.1": | |
| 147, | |
| "codec@1.0.0": | |
| 167, | |
| "codec@2.0.0": | |
| 168, | |
| "codec@2.1.0": | |
| 163, | |
| "codec@3.0.0": | |
| 171, | |
| "codec@3.1.0": | |
| 90, | |
| "codec@4.0.0": | |
| 60, | |
| "codec@4.0.1": | |
| 85, | |
| "codec@5.0.0": | |
| 81, | |
| "codec@6.0.0": | |
| 67, | |
| "codec-argonaut@1.0.0": | |
| 519, | |
| "codec-argonaut@2.0.0": | |
| 373, | |
| "codec-argonaut@2.1.0": | |
| 364, | |
| "codec-argonaut@3.0.0": | |
| 349, | |
| "codec-argonaut@3.1.0": | |
| 362, | |
| "codec-argonaut@3.2.0": | |
| 361, | |
| "codec-argonaut@4.0.0": | |
| 301, | |
| "codec-argonaut@4.1.0": | |
| 446, | |
| "codec-argonaut@4.2.0": | |
| 293, | |
| "codec-argonaut@4.3.0": | |
| 283, | |
| "codec-argonaut@5.0.0": | |
| 231, | |
| "codec-argonaut@6.0.0": | |
| 209, | |
| "codec-argonaut@7.0.0": | |
| 218, | |
| "codec-argonaut@7.0.1": | |
| 229, | |
| "codec-argonaut@7.0.2": | |
| 316, | |
| "codec-argonaut@7.1.0": | |
| 219, | |
| "codec-argonaut@8.0.0": | |
| 96, | |
| "codec-argonaut@9.0.0": | |
| 83, | |
| "codec-argonaut@9.1.0": | |
| 96, | |
| "codec-argonaut@9.2.0": | |
| 99, | |
| "codec-argonaut@10.0.0": | |
| 100, | |
| "coercible@1.0.0": | |
| 76, | |
| "coercible@2.0.0": | |
| 171, | |
| "coercible@2.1.0": | |
| 107, | |
| "coercible@3.0.0": | |
| 177, | |
| "coercions@1.0.0": | |
| 59, | |
| "coercions@2.0.0": | |
| 86, | |
| "coercions@2.1.0": | |
| 70, | |
| "coercions@3.0.0": | |
| 120, | |
| "cofree-react-router@0.3.3": | |
| -413, | |
| "cofree-react-router@0.3.4": | |
| -505, | |
| "cofree-react-router@0.3.5": | |
| -397, | |
| "cofree-react-router@0.3.6": | |
| -381, | |
| "cofree-react-router@1.0.0": | |
| -408, | |
| "cofree-react-router@1.0.1": | |
| -405, | |
| "cofree-react-router@2.0.1": | |
| 627, | |
| "cofree-react-router@2.1.0": | |
| 780, | |
| "cofree-react-router@2.1.1": | |
| 585, | |
| "cofree-react-router@3.0.0": | |
| 582, | |
| "cofree-react-router@3.0.1": | |
| 598, | |
| "cofree-react-router@3.0.2": | |
| 599, | |
| "cofree-react-router@4.0.0": | |
| 596, | |
| "cofree-react-router@5.0.0": | |
| 701, | |
| "cofree-react-router@5.1.0": | |
| 579, | |
| "cofree-react-router@6.0.0": | |
| 584, | |
| "cofree-react-router@6.1.0": | |
| 617, | |
| "cofree-react-router@6.1.1": | |
| -830, | |
| "cofree-react-router@6.1.2": | |
| 939, | |
| "cofree-react-router@6.2.0": | |
| 804, | |
| "cofree-react-router@6.3.0": | |
| 823, | |
| "cofree-react-router@6.4.0": | |
| 833, | |
| "cofree-react-router@6.4.1": | |
| 840, | |
| "cofree-react-router@7.0.0": | |
| 878, | |
| "colehaus-graphs@0.1.0": | |
| -47, | |
| "colehaus-graphs@0.2.0": | |
| 56, | |
| "colehaus-graphs@0.3.0": | |
| 73, | |
| "colehaus-graphs@0.3.1": | |
| 76, | |
| "colehaus-graphs@0.4.0": | |
| 86, | |
| "colehaus-graphs@0.5.0": | |
| 130, | |
| "colehaus-graphs@1.0.0": | |
| 148, | |
| "colehaus-graphs@2.0.0": | |
| 195, | |
| "colehaus-graphs@3.0.0": | |
| 225, | |
| "colehaus-graphs@4.0.0": | |
| 124, | |
| "colehaus-graphs@5.0.1": | |
| 129, | |
| "colehaus-graphs@6.0.0": | |
| 127, | |
| "colehaus-graphs@7.0.0": | |
| 246, | |
| "colehaus-lattice@0.1.0": | |
| 49, | |
| "colehaus-lattice@0.2.0": | |
| 57, | |
| "colehaus-lattice@0.3.0": | |
| 57, | |
| "colehaus-lattice@1.0.0": | |
| 110, | |
| "colehaus-properties@0.1.0": | |
| 62, | |
| "colehaus-properties@0.2.0": | |
| 74, | |
| "colehaus-properties@0.3.0": | |
| 67, | |
| "colehaus-properties@0.3.1": | |
| 114, | |
| "colehaus-properties@0.3.2": | |
| 45, | |
| "color-palettes@0.0.1": | |
| -302, | |
| "colorpalettepicker-halogen@0.1.0": | |
| -1216, | |
| "colorpicker-halogen@0.2.0": | |
| 1327, | |
| "colors@0.4.4": | |
| 126, | |
| "colors@1.0.0": | |
| 61, | |
| "colors@1.0.1": | |
| 65, | |
| "colors@1.0.2": | |
| 67, | |
| "colors@2.0.0": | |
| 167, | |
| "colors@2.1.0": | |
| 147, | |
| "colors@2.2.0": | |
| 242, | |
| "colors@3.0.0": | |
| 166, | |
| "colors@3.1.0": | |
| 184, | |
| "colors@4.0.0": | |
| 186, | |
| "colors@4.1.0": | |
| 199, | |
| "colors@4.2.0": | |
| 201, | |
| "colors@4.3.0": | |
| 203, | |
| "colors@5.0.0": | |
| 136, | |
| "colors@6.0.0": | |
| 211, | |
| "colors@7.0.0": | |
| 88, | |
| "colors@7.0.1": | |
| 78, | |
| "compact@0.0.1": | |
| 45, | |
| "compact@0.0.2": | |
| 67, | |
| "compact@1.0.0": | |
| 67, | |
| "complex@1.0.0": | |
| 63, | |
| "complex@1.0.1": | |
| 107, | |
| "complex@1.1.0": | |
| 194, | |
| "concur-core@0.2.0": | |
| 339, | |
| "concur-core@0.3.0": | |
| 314, | |
| "concur-core@0.3.1": | |
| 309, | |
| "concur-core@0.3.2": | |
| 312, | |
| "concur-core@0.3.3": | |
| 319, | |
| "concur-core@0.3.4": | |
| 322, | |
| "concur-core@0.3.5": | |
| 377, | |
| "concur-core@0.3.6": | |
| 266, | |
| "concur-core@0.3.7": | |
| 264, | |
| "concur-core@0.3.8": | |
| -269, | |
| "concur-core@0.4.0": | |
| 259, | |
| "concur-core@0.4.1": | |
| 257, | |
| "concur-core@0.4.2": | |
| 367, | |
| "concur-core@0.5.0": | |
| 97, | |
| "concur-react@0.2.0": | |
| 324, | |
| "concur-react@0.3.0": | |
| 327, | |
| "concur-react@0.3.1": | |
| 322, | |
| "concur-react@0.3.2": | |
| 327, | |
| "concur-react@0.3.3": | |
| 428, | |
| "concur-react@0.3.4": | |
| 301, | |
| "concur-react@0.3.5": | |
| 262, | |
| "concur-react@0.3.6": | |
| 269, | |
| "concur-react@0.3.7": | |
| 283, | |
| "concur-react@0.3.8": | |
| -278, | |
| "concur-react@0.4.1": | |
| -271, | |
| "concur-react@0.4.2": | |
| -271, | |
| "concur-react@0.5.0": | |
| -551, | |
| "concurrent@0.1.0": | |
| 51, | |
| "concurrent-queues@0.1.0": | |
| 480, | |
| "concurrent-queues@1.0.0": | |
| 319, | |
| "concurrent-queues@1.1.0": | |
| 324, | |
| "concurrent-queues@2.0.0": | |
| 137, | |
| "concurrent-queues@3.0.0": | |
| 217, | |
| "conditional@1.0.0": | |
| 45, | |
| "conditional@1.0.1": | |
| 54, | |
| "conditional@2.0.0": | |
| 58, | |
| "config@0.0.1": | |
| -376, | |
| "config@0.0.2": | |
| -357, | |
| "config@0.0.3": | |
| -379, | |
| "config@0.0.4": | |
| -474, | |
| "config@0.0.5": | |
| -331, | |
| "config@0.0.6": | |
| 431, | |
| "config2@0.0.1": | |
| -355, | |
| "config2@0.0.2": | |
| -351, | |
| "config2@0.0.3": | |
| -346, | |
| "config2@0.0.4": | |
| -465, | |
| "config2@0.0.5": | |
| -333, | |
| "config2@0.0.6": | |
| 435, | |
| "config2@0.1.0": | |
| 180, | |
| "confusables@1.0.0": | |
| 160, | |
| "confusables@1.0.1": | |
| 161, | |
| "cons@0.1.0": | |
| -84, | |
| "consable@0.0.1": | |
| 206, | |
| "console@0.1.0": | |
| 42, | |
| "console@0.1.1": | |
| 54, | |
| "console@1.0.0": | |
| 62, | |
| "console@2.0.0": | |
| 64, | |
| "console@3.0.0": | |
| 72, | |
| "console@4.0.0": | |
| 64, | |
| "console@4.1.0": | |
| 108, | |
| "console@4.2.0": | |
| 48, | |
| "console@4.3.0": | |
| 55, | |
| "console@4.4.0": | |
| 59, | |
| "console@5.0.0": | |
| 73, | |
| "console@6.0.0": | |
| 76, | |
| "console-browser-specific@0.0.1": | |
| 141, | |
| "console-browser-specific@1.0.0": | |
| 74, | |
| "console-browser-specific@1.1.0": | |
| 64, | |
| "console-browser-specific@2.0.0": | |
| 74, | |
| "console-foreign@0.1.0": | |
| 156, | |
| "console-lifted@0.0.1": | |
| 62, | |
| "console-timer@0.0.1": | |
| 74, | |
| "console-timer@0.0.2": | |
| 64, | |
| "console-timer@0.0.3": | |
| 134, | |
| "const@0.1.0": | |
| 67, | |
| "const@0.1.1": | |
| 64, | |
| "const@0.2.0": | |
| 61, | |
| "const@0.3.0": | |
| 85, | |
| "const@0.4.0": | |
| 80, | |
| "const@0.4.1": | |
| 77, | |
| "const@0.5.0": | |
| 95, | |
| "const@1.0.0": | |
| 109, | |
| "const@2.0.0": | |
| 60, | |
| "const@3.0.0": | |
| 73, | |
| "const@3.1.0": | |
| 96, | |
| "const@3.2.0": | |
| 92, | |
| "const@4.0.0": | |
| 76, | |
| "const@4.1.0": | |
| 74, | |
| "const@5.0.0": | |
| 64, | |
| "const@6.0.0": | |
| 130, | |
| "context@0.0.1": | |
| 46, | |
| "context@0.0.2": | |
| 46, | |
| "context@0.0.3": | |
| 53, | |
| "context@1.0.0": | |
| 70, | |
| "contravariant@0.0.1": | |
| 72, | |
| "contravariant@0.1.0": | |
| 76, | |
| "contravariant@0.2.0": | |
| 113, | |
| "contravariant@0.2.1": | |
| 58, | |
| "contravariant@0.2.2": | |
| 51, | |
| "contravariant@0.2.3": | |
| 72, | |
| "contravariant@1.0.0": | |
| 71, | |
| "contravariant@2.0.0": | |
| 103, | |
| "contravariant@3.0.0": | |
| 147, | |
| "contravariant@3.1.0": | |
| 83, | |
| "contravariant@3.2.0": | |
| 64, | |
| "contravariant@3.3.0": | |
| 67, | |
| "contravariant@4.0.0": | |
| 75, | |
| "contravariant@4.0.1": | |
| 73, | |
| "contravariant@5.0.0": | |
| 62, | |
| "contravariant@6.0.0": | |
| 72, | |
| "control@0.1.0": | |
| 63, | |
| "control@0.1.1": | |
| 108, | |
| "control@0.2.0": | |
| 42, | |
| "control@0.2.1": | |
| 51, | |
| "control@0.2.2": | |
| 67, | |
| "control@0.2.3": | |
| 67, | |
| "control@0.2.4": | |
| 128, | |
| "control@0.2.5": | |
| 43, | |
| "control@0.2.6": | |
| 52, | |
| "control@0.3.0": | |
| 55, | |
| "control@0.3.1": | |
| 67, | |
| "control@0.3.2": | |
| 67, | |
| "control@1.0.0": | |
| 66, | |
| "control@2.0.0": | |
| 105, | |
| "control@3.0.0": | |
| 46, | |
| "control@3.1.0": | |
| 50, | |
| "control@3.2.0": | |
| 63, | |
| "control@3.3.0": | |
| 67, | |
| "control@3.3.1": | |
| 67, | |
| "control@4.0.0": | |
| 107, | |
| "control@4.1.0": | |
| 45, | |
| "control@4.2.0": | |
| 53, | |
| "control@5.0.0": | |
| 66, | |
| "control@6.0.0": | |
| 68, | |
| "convertable-options@1.0.0": | |
| 74, | |
| "conveyor@0.0.1": | |
| 485, | |
| "conveyor@0.1.0": | |
| 329, | |
| "conveyor@0.1.1": | |
| 322, | |
| "conveyor@0.2.0": | |
| 330, | |
| "conveyor@0.3.0": | |
| 338, | |
| "conveyor@0.3.1": | |
| 344, | |
| "conveyor@0.3.2": | |
| 342, | |
| "conveyor@0.4.0": | |
| 455, | |
| "conveyor@0.4.1": | |
| 328, | |
| "conveyor@0.4.2": | |
| 561, | |
| "conveyor@0.5.0": | |
| 591, | |
| "conveyor@0.5.1": | |
| 598, | |
| "conveyor@0.5.2": | |
| 704, | |
| "conveyor@0.5.3": | |
| 592, | |
| "conveyor@0.5.4": | |
| 575, | |
| "conveyor@0.5.5": | |
| 586, | |
| "conveyor@0.5.6": | |
| 602, | |
| "conveyor@0.6.0": | |
| 605, | |
| "conveyor@0.7.0": | |
| 609, | |
| "conveyor@0.8.0": | |
| 693, | |
| "conveyor@0.9.0": | |
| 506, | |
| "conveyor@0.10.0": | |
| 503, | |
| "conveyor@0.11.0": | |
| 337, | |
| "conveyor@0.12.0": | |
| 327, | |
| "conveyor@0.12.1": | |
| 335, | |
| "conveyor@0.12.2": | |
| 428, | |
| "conveyor@0.13.0": | |
| 318, | |
| "conveyor@0.14.0": | |
| 414, | |
| "conveyor@0.14.1": | |
| 436, | |
| "conveyor@0.15.0": | |
| 438, | |
| "conveyor@0.16.0": | |
| 511, | |
| "conveyor@0.17.0": | |
| 428, | |
| "conveyor@1.0.0": | |
| 412, | |
| "conveyor@2.0.0": | |
| 418, | |
| "conveyor@2.1.0": | |
| 432, | |
| "conveyor-basic-auth@1.0.0": | |
| 550, | |
| "conveyor-basic-auth@1.1.0": | |
| 552, | |
| "conveyor-basic-auth@1.2.0": | |
| 631, | |
| "conveyor-cors@0.1.0": | |
| 446, | |
| "conveyor-cors@0.1.1": | |
| 434, | |
| "conveyor-cors@0.1.2": | |
| 676, | |
| "conveyor-cors@0.2.0": | |
| 745, | |
| "conveyor-cors@0.2.1": | |
| 745, | |
| "conveyor-cors@0.3.0": | |
| 742, | |
| "conveyor-cors@0.4.0": | |
| 874, | |
| "conveyor-cors@0.4.1": | |
| 705, | |
| "conveyor-cors@0.5.0": | |
| 818, | |
| "conveyor-cors@0.6.0": | |
| 826, | |
| "conveyor-cors@0.7.0": | |
| 607, | |
| "conveyor-cors@0.7.1": | |
| 687, | |
| "conveyor-cors@0.8.0": | |
| 600, | |
| "conveyor-cors@0.8.1": | |
| 723, | |
| "conveyor-cors@0.9.0": | |
| 831, | |
| "conveyor-cors@1.0.0": | |
| 535, | |
| "conveyor-health@1.0.0": | |
| 531, | |
| "cookie@0.1.0": | |
| 311, | |
| "cookie@0.1.1": | |
| 311, | |
| "cookie@0.1.2": | |
| 397, | |
| "cookie@0.1.3": | |
| 308, | |
| "cookie@0.2.0": | |
| 671, | |
| "cookie@0.3.0": | |
| 678, | |
| "cookie@1.0.0": | |
| 283, | |
| "coproducts@0.1.0": | |
| 63, | |
| "coproducts@0.2.0": | |
| 78, | |
| "coproducts@0.3.0": | |
| 73, | |
| "coproducts@0.3.1": | |
| 154, | |
| "coproducts@0.4.0": | |
| 51, | |
| "coproducts@0.4.1": | |
| 68, | |
| "coroutines@0.2.2": | |
| 85, | |
| "coroutines@0.2.3": | |
| 77, | |
| "coroutines@0.2.4": | |
| 77, | |
| "coroutines@0.3.0": | |
| 84, | |
| "coroutines@0.3.1": | |
| 150, | |
| "coroutines@0.4.0": | |
| 80, | |
| "coroutines@0.5.0": | |
| 85, | |
| "coroutines@1.0.0": | |
| 68, | |
| "coroutines@1.1.0": | |
| 78, | |
| "coroutines@1.2.0": | |
| 77, | |
| "coroutines@1.3.0": | |
| 80, | |
| "coroutines@2.0.0": | |
| 129, | |
| "coroutines@2.0.1": | |
| 69, | |
| "coroutines@3.0.0": | |
| 154, | |
| "coroutines@3.0.1": | |
| 145, | |
| "coroutines@3.1.0": | |
| -117, | |
| "coroutines@4.0.0": | |
| 145, | |
| "coroutines@5.0.0": | |
| 206, | |
| "coroutines@5.0.1": | |
| 232, | |
| "coroutines@6.0.0": | |
| 111, | |
| "coroutines@7.0.0": | |
| 90, | |
| "cowlaser@0.0.1": | |
| 89, | |
| "cowlaser@0.1.0": | |
| 84, | |
| "cowlaser@0.2.0": | |
| 83, | |
| "cowlaser@0.3.0": | |
| 90, | |
| "cowlaser@0.4.0": | |
| 193, | |
| "cowlaser@0.5.0": | |
| 94, | |
| "cowlaser@0.6.0": | |
| 75, | |
| "cowlaser@0.7.0": | |
| 78, | |
| "creditcard-validation@1.0.0": | |
| 132, | |
| "creditcard-validation@1.0.1": | |
| 130, | |
| "creditcard-validation@1.0.2": | |
| 125, | |
| "crypt-nacl@0.1.0": | |
| 64, | |
| "crypt-nacl@0.2.0": | |
| 158, | |
| "crypt-nacl@0.3.0": | |
| 77, | |
| "crypto@0.1.0": | |
| 48, | |
| "crypto@0.1.1": | |
| 75, | |
| "crypto@0.1.2": | |
| 75, | |
| "crypto@0.1.3": | |
| 72, | |
| "crypto@0.2.0": | |
| 70, | |
| "crypto@1.0.0": | |
| 131, | |
| "crypto@1.1.0": | |
| 54, | |
| "crypto@2.0.0": | |
| 61, | |
| "crypto@2.0.1": | |
| 139, | |
| "crypto@2.1.0": | |
| 94, | |
| "crypto@3.0.0": | |
| 78, | |
| "crypto@4.0.0": | |
| 145, | |
| "crypto@5.0.0": | |
| 182, | |
| "crypto@5.0.1": | |
| 85, | |
| "css@0.1.0": | |
| 63, | |
| "css@0.3.0": | |
| -78, | |
| "css@0.3.1": | |
| -86, | |
| "css@0.4.0": | |
| -79, | |
| "css@0.5.0": | |
| -173, | |
| "css@0.5.1": | |
| -87, | |
| "css@0.5.2": | |
| -69, | |
| "css@0.6.0": | |
| -86, | |
| "css@0.7.0": | |
| -82, | |
| "css@1.0.0": | |
| 78, | |
| "css@1.1.0": | |
| 81, | |
| "css@2.0.0": | |
| 199, | |
| "css@2.1.0": | |
| 290, | |
| "css@3.0.0": | |
| 191, | |
| "css@3.1.0": | |
| 236, | |
| "css@3.2.0": | |
| 244, | |
| "css@3.3.0": | |
| 254, | |
| "css@3.4.0": | |
| 254, | |
| "css@4.0.0": | |
| 253, | |
| "css@5.0.0": | |
| 164, | |
| "css@5.0.1": | |
| 167, | |
| "css@6.0.0": | |
| 104, | |
| "css-bem@0.0.1": | |
| 110, | |
| "css-bem@0.0.2": | |
| 320, | |
| "css-properties@0.1.0": | |
| 41, | |
| "css-properties@0.2.0": | |
| 53, | |
| "css-properties@0.3.0": | |
| 57, | |
| "css-validate@0.1.0": | |
| 70, | |
| "css-validate@0.2.0": | |
| 66, | |
| "css-validate@0.3.0": | |
| 65, | |
| "css-validate@0.4.0": | |
| 76, | |
| "css-validate@0.5.0": | |
| 134, | |
| "css-validate@0.6.0": | |
| 70, | |
| "cssom@0.0.2": | |
| 54, | |
| "csv@1.2.2": | |
| 94, | |
| "csv@1.3.0": | |
| -282, | |
| "csv@1.3.1": | |
| 277, | |
| "csv@2.0.0": | |
| 326, | |
| "csv@3.0.0": | |
| 190, | |
| "cycle@0.0.1": | |
| 72, | |
| "cycle@0.0.2": | |
| 81, | |
| "cycle-run@0.1.0": | |
| 71, | |
| "cycle-run@0.2.0": | |
| 511, | |
| "cycle-run@0.3.0": | |
| 390, | |
| "cycle-run@0.4.0": | |
| 502, | |
| "cycle-run@0.5.0": | |
| 373, | |
| "cycle-run@0.6.0": | |
| 1425, | |
| "cycle-run@0.7.0": | |
| 1440, | |
| "cycle-run@0.8.0": | |
| 1259, | |
| "cycle-run@1.0.0": | |
| 1445, | |
| "d3@0.1.0": | |
| 133, | |
| "d3@0.1.1": | |
| 52, | |
| "d3@0.2.0": | |
| -54, | |
| "d3@0.3.0": | |
| -58, | |
| "d3@0.4.0": | |
| -69, | |
| "d3@0.4.1": | |
| -67, | |
| "d3@0.5.0": | |
| -69, | |
| "d3@0.6.0": | |
| -70, | |
| "d3@0.7.0": | |
| 154, | |
| "d3@0.8.0": | |
| 63, | |
| "d3@0.8.1": | |
| 68, | |
| "d3@0.9.0": | |
| 507, | |
| "data-algebrae@1.0.0": | |
| 152, | |
| "data-algebrae@2.0.0": | |
| 291, | |
| "data-algebrae@2.1.0": | |
| -348, | |
| "data-algebrae@2.2.0": | |
| -343, | |
| "data-algebrae@2.2.1": | |
| -374, | |
| "data-algebrae@3.0.0": | |
| -365, | |
| "data-algebrae@3.1.0": | |
| -380, | |
| "data-algebrae@4.0.0": | |
| 398, | |
| "data-default@0.1.0": | |
| 112, | |
| "dataframe@0.1.0": | |
| 207, | |
| "dataframe@0.1.1": | |
| 165, | |
| "dataframe@0.1.2": | |
| 177, | |
| "dataframe@0.1.3": | |
| 175, | |
| "dataframe@0.1.4": | |
| 306, | |
| "date-fns@1.0.0": | |
| 167, | |
| "date-fns@1.0.1": | |
| 78, | |
| "date-fns@1.0.2": | |
| 63, | |
| "date-fns@1.0.3": | |
| 72, | |
| "date-helpers@1.0.0": | |
| 101, | |
| "datetime@0.0.1": | |
| -60, | |
| "datetime@0.1.0": | |
| 81, | |
| "datetime@0.1.1": | |
| 68, | |
| "datetime@0.1.2": | |
| 140, | |
| "datetime@0.2.0": | |
| -86, | |
| "datetime@0.3.0": | |
| 78, | |
| "datetime@0.3.1": | |
| 84, | |
| "datetime@0.4.0": | |
| 79, | |
| "datetime@0.5.0": | |
| 74, | |
| "datetime@0.5.1": | |
| 77, | |
| "datetime@0.5.2": | |
| 91, | |
| "datetime@0.5.3": | |
| 108, | |
| "datetime@0.6.0": | |
| 62, | |
| "datetime@0.7.0": | |
| 61, | |
| "datetime@0.8.0": | |
| 82, | |
| "datetime@0.9.0": | |
| 78, | |
| "datetime@0.9.1": | |
| 129, | |
| "datetime@0.9.2": | |
| 71, | |
| "datetime@1.0.0": | |
| 51, | |
| "datetime@2.0.0": | |
| 137, | |
| "datetime@2.1.0": | |
| 128, | |
| "datetime@2.1.1": | |
| 129, | |
| "datetime@2.2.0": | |
| 200, | |
| "datetime@3.0.0": | |
| 164, | |
| "datetime@3.1.0": | |
| 187, | |
| "datetime@3.2.0": | |
| 192, | |
| "datetime@3.3.0": | |
| 246, | |
| "datetime@3.4.0": | |
| 319, | |
| "datetime@3.4.1": | |
| 225, | |
| "datetime@4.0.0": | |
| 114, | |
| "datetime@4.1.0": | |
| 118, | |
| "datetime@4.1.1": | |
| 132, | |
| "datetime@5.0.0": | |
| 99, | |
| "datetime@5.0.1": | |
| 100, | |
| "datetime@5.0.2": | |
| 100, | |
| "datetime@6.0.0": | |
| 198, | |
| "datetime@6.1.0": | |
| 101, | |
| "datetime-iso@1.0.0": | |
| 310, | |
| "datetime-iso@1.0.1": | |
| 303, | |
| "datetime-iso@1.0.2": | |
| 309, | |
| "datetime-iso@2.0.0": | |
| 237, | |
| "datetime-iso@2.0.2": | |
| 236, | |
| "datetime-iso@3.0.0": | |
| 382, | |
| "datetime-iso@4.0.0": | |
| 247, | |
| "datetime-parsing@0.1.0": | |
| 95, | |
| "datetime-parsing@0.2.0": | |
| 93, | |
| "day@1.0.0": | |
| 65, | |
| "day@2.0.0": | |
| 71, | |
| "day@2.1.0": | |
| 63, | |
| "day@3.0.0": | |
| 78, | |
| "day@3.1.0": | |
| 184, | |
| "day@4.0.0": | |
| 67, | |
| "day@4.1.0": | |
| 59, | |
| "day@5.0.0": | |
| 68, | |
| "day@5.1.0": | |
| 72, | |
| "day@6.0.0": | |
| 72, | |
| "day@7.0.0": | |
| 319, | |
| "day@8.0.0": | |
| -350, | |
| "day@9.0.0": | |
| 282, | |
| "day@9.0.1": | |
| 265, | |
| "day@9.1.0": | |
| 266, | |
| "day@9.2.0": | |
| 273, | |
| "day@10.0.0": | |
| 178, | |
| "day@10.0.1": | |
| 179, | |
| "debug@0.1.0": | |
| 56, | |
| "debug@0.1.1": | |
| 101, | |
| "debug@0.1.2": | |
| 42, | |
| "debug@0.1.3": | |
| 43, | |
| "debug@0.1.4": | |
| 59, | |
| "debug@0.1.5": | |
| 58, | |
| "debug@0.1.6": | |
| 114, | |
| "debug@0.1.7": | |
| 49, | |
| "debug@1.0.0": | |
| 43, | |
| "debug@2.0.0": | |
| 43, | |
| "debug@3.0.0": | |
| 64, | |
| "debug@4.0.0": | |
| 62, | |
| "debug@4.0.1": | |
| 59, | |
| "debug@5.0.0": | |
| 59, | |
| "debug@6.0.0": | |
| 122, | |
| "debug@6.0.1": | |
| 48, | |
| "debug@6.0.2": | |
| 42, | |
| "debug-foreign@0.0.2": | |
| 48, | |
| "debug-foreign@0.0.3": | |
| 55, | |
| "debug-foreign@0.0.4": | |
| 57, | |
| "debugged@0.1.0": | |
| 199, | |
| "debugger@1.0.1": | |
| 191, | |
| "debugger@2.0.0": | |
| 693, | |
| "debugger@3.0.0": | |
| 177, | |
| "debuggest@0.3.1": | |
| 49, | |
| "debuggest@0.4.0": | |
| 59, | |
| "debuggest@0.4.1": | |
| 59, | |
| "debuggest@0.5.0": | |
| 60, | |
| "debuggest@0.5.1": | |
| 60, | |
| "decimal@1.0.0": | |
| 124, | |
| "decimal@2.0.0": | |
| 52, | |
| "decimals@1.0.0": | |
| 49, | |
| "decimals@1.1.0": | |
| 52, | |
| "decimals@1.2.0": | |
| 60, | |
| "decimals@1.3.0": | |
| 60, | |
| "decimals@1.4.0": | |
| 63, | |
| "decimals@2.0.0": | |
| 122, | |
| "decimals@2.1.0": | |
| 59, | |
| "decimals@3.0.0": | |
| 54, | |
| "decimals@3.1.0": | |
| 62, | |
| "decimals@3.2.0": | |
| 61, | |
| "decimals@3.3.0": | |
| 60, | |
| "decimals@3.4.0": | |
| 103, | |
| "decimals@4.0.0": | |
| 82, | |
| "decimals@5.0.0": | |
| 44, | |
| "decimals@6.0.0": | |
| 45, | |
| "decimals@7.0.0": | |
| 60, | |
| "decimals@7.1.0": | |
| 59, | |
| "decision-theory@0.0.1": | |
| 121, | |
| "decision-theory@0.0.2": | |
| 113, | |
| "decision-theory@0.1.0": | |
| 166, | |
| "decision-theory@0.1.1": | |
| 178, | |
| "decision-theory@0.1.2": | |
| 139, | |
| "default@1.0.0": | |
| 94, | |
| "default@2.1.0": | |
| 147, | |
| "default-values@1.0.0": | |
| 59, | |
| "default-values@1.0.1": | |
| 83, | |
| "deku@0.0.0": | |
| -401, | |
| "deku@0.0.1": | |
| -524, | |
| "deku@0.0.2": | |
| -377, | |
| "deku@0.0.3": | |
| -375, | |
| "deku@0.0.4": | |
| -394, | |
| "deku@0.0.5": | |
| -395, | |
| "deku@0.0.6": | |
| -398, | |
| "deku@0.0.7": | |
| -401, | |
| "deku@0.0.8": | |
| -495, | |
| "deku@0.1.0": | |
| -386, | |
| "deku@0.1.1": | |
| -88, | |
| "deku@0.1.2": | |
| -96, | |
| "deku@0.1.3": | |
| -98, | |
| "deku@0.2.1": | |
| -99, | |
| "deku@0.2.2": | |
| -173, | |
| "deku@0.2.3": | |
| -90, | |
| "deku@0.2.4": | |
| -88, | |
| "deku@0.2.5": | |
| -97, | |
| "deku@0.2.6": | |
| -100, | |
| "deku@0.3.0": | |
| -409, | |
| "deku@0.3.1": | |
| -500, | |
| "deku@0.3.2": | |
| -384, | |
| "deku@0.3.3": | |
| -389, | |
| "deku@0.3.4": | |
| -402, | |
| "deku@0.3.5": | |
| -407, | |
| "deku@0.3.6": | |
| -474, | |
| "deku@0.3.7": | |
| -369, | |
| "deku@0.3.8": | |
| -359, | |
| "deku@0.4.0": | |
| -151, | |
| "deku@0.4.1": | |
| -175, | |
| "deku@0.4.2": | |
| -174, | |
| "deku@0.4.3": | |
| -255, | |
| "deku@0.4.4": | |
| -172, | |
| "deku@0.4.5": | |
| -166, | |
| "deku@0.4.6": | |
| -170, | |
| "deku@0.4.7": | |
| -179, | |
| "deku@0.4.8": | |
| -218, | |
| "deku@0.4.9": | |
| -218, | |
| "deku@0.4.10": | |
| -216, | |
| "deku@0.4.11": | |
| -322, | |
| "deku@0.4.12": | |
| -206, | |
| "deku@0.4.13": | |
| 222, | |
| "deku@0.5.2": | |
| 141, | |
| "deku@0.6.0": | |
| 141, | |
| "deku@0.6.1": | |
| 138, | |
| "deku@0.8.1": | |
| 123, | |
| "deku@0.8.2": | |
| 210, | |
| "deku@0.8.3": | |
| 106, | |
| "deku@0.8.4": | |
| 114, | |
| "deku@0.8.5": | |
| 115, | |
| "deku@0.8.6": | |
| 119, | |
| "deku@0.9.0": | |
| 118, | |
| "deku@0.9.1": | |
| 239, | |
| "deku@0.9.2": | |
| 110, | |
| "deku@0.9.3": | |
| 114, | |
| "deku@0.9.4": | |
| 120, | |
| "deku@0.9.5": | |
| 122, | |
| "deno@0.0.2": | |
| 117, | |
| "deno@0.0.3": | |
| 118, | |
| "deno@0.0.4": | |
| 197, | |
| "deno@0.0.5": | |
| 111, | |
| "density-codensity@1.0.0": | |
| 52, | |
| "density-codensity@1.0.1": | |
| 56, | |
| "density-codensity@1.0.2": | |
| 110, | |
| "des@0.0.1": | |
| 64, | |
| "dexie@0.1.0": | |
| 119, | |
| "dexie@0.1.1": | |
| 112, | |
| "dexie@0.1.2": | |
| 199, | |
| "dexie@0.2.0": | |
| 100, | |
| "dexie@0.2.1": | |
| 98, | |
| "dexie@0.3.0": | |
| 105, | |
| "diff@0.0.0": | |
| 233, | |
| "diff@0.0.1": | |
| 229, | |
| "diff@0.0.2": | |
| 258, | |
| "difference-containers@0.0.1": | |
| 67, | |
| "difference-containers@0.0.2": | |
| 152, | |
| "difference-containers@1.0.0": | |
| 76, | |
| "difference-containers@1.0.1": | |
| 63, | |
| "difflists@2.0.0": | |
| 58, | |
| "difflists@2.0.1": | |
| 72, | |
| "difflists@2.1.0": | |
| 72, | |
| "difflists@3.0.0": | |
| 66, | |
| "difflists@3.0.1": | |
| 65, | |
| "digraph@0.1.0": | |
| 180, | |
| "digraph@0.1.1": | |
| 68, | |
| "digraph@0.1.2": | |
| 75, | |
| "digraph@0.1.3": | |
| 81, | |
| "digraph@0.2.0": | |
| 79, | |
| "digraph@0.3.0": | |
| 80, | |
| "digraph@0.4.0": | |
| 80, | |
| "digraph@0.5.0": | |
| 342, | |
| "digraph@1.0.0": | |
| 239, | |
| "digraph@1.0.1": | |
| 169, | |
| "digraph@1.0.2": | |
| 178, | |
| "digraph@1.1.0": | |
| 187, | |
| "digraph@1.1.1": | |
| 186, | |
| "digraph@1.1.2": | |
| 186, | |
| "digraph@1.1.3": | |
| 188, | |
| "digraph@2.0.0": | |
| 217, | |
| "dispatcher-react@1.0.0": | |
| -383, | |
| "dispatcher-react@2.0.0": | |
| 454, | |
| "dispatcher-react@2.1.0": | |
| 444, | |
| "dispatcher-react@3.0.0": | |
| 424, | |
| "dispatcher-react@3.1.0": | |
| 437, | |
| "dispatcher-react@4.0.0": | |
| 340, | |
| "dissect@0.1.0": | |
| 52, | |
| "dissect@1.0.0": | |
| 59, | |
| "distributions@1.1.0": | |
| 59, | |
| "distributions@2.0.0": | |
| 145, | |
| "distributions@3.0.0": | |
| 180, | |
| "distributions@4.0.0": | |
| 82, | |
| "distributive@0.0.1": | |
| -54, | |
| "distributive@0.1.0": | |
| -79, | |
| "distributive@0.1.1": | |
| -103, | |
| "distributive@0.2.0": | |
| 57, | |
| "distributive@0.3.0": | |
| 50, | |
| "distributive@0.4.0": | |
| 71, | |
| "distributive@0.4.1": | |
| 71, | |
| "distributive@0.5.0": | |
| 63, | |
| "distributive@0.5.1": | |
| 66, | |
| "distributive@1.0.0": | |
| 61, | |
| "distributive@2.0.0": | |
| 139, | |
| "distributive@3.0.0": | |
| 54, | |
| "distributive@4.0.0": | |
| 59, | |
| "distributive@5.0.0": | |
| 52, | |
| "distributive@6.0.0": | |
| 61, | |
| "dodo-printer@1.0.0": | |
| 320, | |
| "dodo-printer@1.0.1": | |
| 309, | |
| "dodo-printer@1.0.2": | |
| 401, | |
| "dodo-printer@1.0.3": | |
| 297, | |
| "dodo-printer@1.0.4": | |
| 292, | |
| "dodo-printer@1.0.5": | |
| 305, | |
| "dodo-printer@1.0.6": | |
| 303, | |
| "dodo-printer@1.0.7": | |
| 303, | |
| "dodo-printer@1.0.8": | |
| 203, | |
| "dodo-printer@1.0.9": | |
| 115, | |
| "dodo-printer@1.1.0": | |
| 295, | |
| "dodo-printer@1.1.1": | |
| 305, | |
| "dodo-printer@2.0.0": | |
| 141, | |
| "dodo-printer@2.1.0": | |
| 242, | |
| "dodo-printer@2.2.0": | |
| 9487, | |
| "dodo-printer@2.2.1": | |
| 117, | |
| "dom@0.1.0": | |
| 54, | |
| "dom@0.1.1": | |
| 52, | |
| "dom@0.1.2": | |
| 134, | |
| "dom@0.1.3": | |
| 49, | |
| "dom@0.2.0": | |
| 89, | |
| "dom@0.2.1": | |
| 66, | |
| "dom@0.2.2": | |
| 75, | |
| "dom@0.2.3": | |
| 76, | |
| "dom@0.2.4": | |
| 77, | |
| "dom@0.2.5": | |
| 74, | |
| "dom@0.2.6": | |
| 145, | |
| "dom@0.2.7": | |
| 76, | |
| "dom@0.2.8": | |
| 58, | |
| "dom@0.2.9": | |
| 58, | |
| "dom@0.2.10": | |
| 73, | |
| "dom@0.2.11": | |
| 75, | |
| "dom@0.2.12": | |
| 73, | |
| "dom@0.2.13": | |
| 76, | |
| "dom@0.2.14": | |
| 153, | |
| "dom@0.2.15": | |
| 78, | |
| "dom@0.2.16": | |
| 63, | |
| "dom@0.2.17": | |
| 61, | |
| "dom@0.2.18": | |
| 76, | |
| "dom@0.2.19": | |
| 76, | |
| "dom@0.2.20": | |
| 78, | |
| "dom@0.2.21": | |
| 79, | |
| "dom@0.2.22": | |
| 157, | |
| "dom@1.0.0": | |
| 65, | |
| "dom@1.1.0": | |
| 50, | |
| "dom@1.2.0": | |
| 51, | |
| "dom@2.0.0": | |
| -203, | |
| "dom@2.0.1": | |
| -196, | |
| "dom@2.1.0": | |
| -206, | |
| "dom@2.2.0": | |
| -207, | |
| "dom@2.2.1": | |
| -398, | |
| "dom@3.0.0": | |
| -239, | |
| "dom@3.1.0": | |
| 298, | |
| "dom@3.2.0": | |
| -198, | |
| "dom@3.3.0": | |
| -533, | |
| "dom@3.3.1": | |
| -238, | |
| "dom@3.4.0": | |
| -241, | |
| "dom@3.5.0": | |
| -324, | |
| "dom@3.5.1": | |
| -1643, | |
| "dom@3.6.0": | |
| -290, | |
| "dom@3.7.0": | |
| -296, | |
| "dom@3.8.0": | |
| -354, | |
| "dom@3.8.1": | |
| -353, | |
| "dom@4.0.0": | |
| 385, | |
| "dom@4.1.0": | |
| 575, | |
| "dom@4.1.1": | |
| 545, | |
| "dom@4.2.0": | |
| 291, | |
| "dom@4.3.0": | |
| 285, | |
| "dom@4.3.1": | |
| 288, | |
| "dom@4.4.0": | |
| 302, | |
| "dom@4.4.1": | |
| 306, | |
| "dom@4.5.0": | |
| 469, | |
| "dom@4.6.0": | |
| 317, | |
| "dom@4.6.1": | |
| 299, | |
| "dom@4.7.0": | |
| 310, | |
| "dom@4.8.0": | |
| 318, | |
| "dom@4.8.1": | |
| 310, | |
| "dom@4.8.2": | |
| 402, | |
| "dom@4.8.3": | |
| 283, | |
| "dom@4.9.0": | |
| 276, | |
| "dom@4.10.0": | |
| 291, | |
| "dom@4.11.0": | |
| 294, | |
| "dom@4.12.0": | |
| 318, | |
| "dom@4.13.0": | |
| 378, | |
| "dom@4.13.1": | |
| 285, | |
| "dom@4.13.2": | |
| 282, | |
| "dom@4.14.0": | |
| 280, | |
| "dom@4.15.0": | |
| 342, | |
| "dom@4.16.0": | |
| 304, | |
| "dom@5.0.0": | |
| 323, | |
| "dom-classy@1.0.0": | |
| -347, | |
| "dom-classy@1.1.0": | |
| -420, | |
| "dom-classy@1.2.0": | |
| -281, | |
| "dom-classy@1.3.0": | |
| -281, | |
| "dom-classy@1.4.0": | |
| -293, | |
| "dom-classy@2.0.0": | |
| 751, | |
| "dom-classy@2.1.0": | |
| 892, | |
| "dom-classy@2.2.0": | |
| 739, | |
| "dom-delegator@0.1.0": | |
| 43, | |
| "dom-filereader@1.0.0": | |
| 543, | |
| "dom-filereader@2.0.0": | |
| 814, | |
| "dom-filereader@3.0.0": | |
| 790, | |
| "dom-filereader@4.0.0": | |
| 453, | |
| "dom-filereader@5.0.0": | |
| 519, | |
| "dom-filereader@6.0.0": | |
| 154, | |
| "dom-filereader@7.0.0": | |
| 119, | |
| "dom-indexed@1.0.0": | |
| -271, | |
| "dom-indexed@1.0.1": | |
| -277, | |
| "dom-indexed@1.0.2": | |
| -271, | |
| "dom-indexed@1.1.0": | |
| -359, | |
| "dom-indexed@2.0.0": | |
| -229, | |
| "dom-indexed@3.0.0": | |
| 332, | |
| "dom-indexed@4.0.0": | |
| 428, | |
| "dom-indexed@5.0.0": | |
| 429, | |
| "dom-indexed@6.0.0": | |
| 1142, | |
| "dom-indexed@7.0.0": | |
| 1293, | |
| "dom-indexed@8.0.0": | |
| 360, | |
| "dom-indexed@8.0.1": | |
| 353, | |
| "dom-indexed@9.0.0": | |
| 224, | |
| "dom-indexed@10.0.0": | |
| 231, | |
| "dom-indexed@11.0.0": | |
| 196, | |
| "dom-parser@1.0.0": | |
| 500, | |
| "dom-parser@2.0.1": | |
| 302, | |
| "dom-parser@3.0.0": | |
| 397, | |
| "dom-parser@4.0.0": | |
| 280, | |
| "dominator-core@0.1.0": | |
| 359, | |
| "dominator-core@0.1.1": | |
| 374, | |
| "domparser@0.0.1": | |
| 56, | |
| "dotenv@0.1.0": | |
| 352, | |
| "dotenv@0.1.1": | |
| 425, | |
| "dotenv@0.1.2": | |
| 325, | |
| "dotenv@0.1.3": | |
| 325, | |
| "dotenv@0.1.4": | |
| 344, | |
| "dotenv@0.1.5": | |
| 353, | |
| "dotenv@0.2.0": | |
| 341, | |
| "dotenv@0.2.1": | |
| 433, | |
| "dotenv@0.2.2": | |
| 324, | |
| "dotenv@0.3.0": | |
| 366, | |
| "dotenv@0.4.0": | |
| 341, | |
| "dotenv@0.4.1": | |
| 337, | |
| "dotenv@1.0.0": | |
| 365, | |
| "dotenv@1.1.0": | |
| 480, | |
| "dotenv@2.0.0": | |
| -396, | |
| "dotenv@3.0.0": | |
| 125, | |
| "dotlang@1.0.0": | |
| 144, | |
| "dotlang@1.0.1": | |
| 145, | |
| "dotlang@1.0.2": | |
| 198, | |
| "dotlang@1.1.0": | |
| 200, | |
| "dotlang@1.2.0": | |
| 259, | |
| "dotlang@2.0.0": | |
| 133, | |
| "dotlang@3.0.1": | |
| 130, | |
| "dotlang@3.1.0": | |
| 309, | |
| "dotlang@4.0.0": | |
| 103, | |
| "downloadjs@1.0.0": | |
| 317, | |
| "drawing@0.1.0": | |
| 75, | |
| "drawing@0.2.0": | |
| 157, | |
| "drawing@0.3.0": | |
| 75, | |
| "drawing@0.3.1": | |
| 60, | |
| "drawing@0.3.2": | |
| 80, | |
| "drawing@0.3.3": | |
| 89, | |
| "drawing@0.3.4": | |
| 87, | |
| "drawing@0.3.5": | |
| 80, | |
| "drawing@0.3.6": | |
| 164, | |
| "drawing@0.3.7": | |
| 73, | |
| "drawing@0.3.8": | |
| 62, | |
| "drawing@0.4.0": | |
| -77, | |
| "drawing@0.5.0": | |
| 84, | |
| "drawing@1.0.0": | |
| 78, | |
| "drawing@2.0.0": | |
| 183, | |
| "drawing@2.1.0": | |
| 262, | |
| "drawing@3.0.0": | |
| 181, | |
| "drawing@4.0.0": | |
| 106, | |
| "droplet@0.1.0": | |
| 147, | |
| "droplet@0.2.0": | |
| 157, | |
| "droplet@0.3.0": | |
| 169, | |
| "droplet@0.4.0": | |
| 216, | |
| "droplet@0.5.0": | |
| 127, | |
| "dual-tree@0.0.2": | |
| 323, | |
| "dynamic-buffer@1.0.0": | |
| 41, | |
| "dynamic-buffer@1.0.1": | |
| 76, | |
| "dynamic-buffer@2.0.0": | |
| 68, | |
| "dynamic-buffer@3.0.0": | |
| 66, | |
| "dynamic-buffer@3.0.1": | |
| 67, | |
| "dynamodb@0.1.0": | |
| -300, | |
| "dynamodb@0.2.0": | |
| -208, | |
| "dynamodb@0.2.1": | |
| -194, | |
| "dynamodb@0.2.2": | |
| -202, | |
| "each@0.0.1": | |
| -70, | |
| "easings@1.0.0": | |
| 96, | |
| "easings@1.0.1": | |
| 66, | |
| "easings@2.0.0": | |
| 71, | |
| "easings@2.1.0": | |
| 155, | |
| "easy-alexa@0.0.1": | |
| 392, | |
| "easy-alexa@0.0.2": | |
| 332, | |
| "easy-alexa@0.0.3": | |
| 336, | |
| "easy-alexa@0.0.4": | |
| 344, | |
| "easy-alexa@0.0.5": | |
| 354, | |
| "easy-alexa@0.0.6": | |
| 363, | |
| "easy-alexa@0.0.7": | |
| 353, | |
| "easy-alexa@0.0.8": | |
| 432, | |
| "easy-alexa@0.0.9": | |
| 339, | |
| "easy-alexa@0.0.10": | |
| 336, | |
| "easy-ffi@1.0.0": | |
| 55, | |
| "easy-ffi@1.0.1": | |
| 76, | |
| "easy-ffi@1.0.2": | |
| 118, | |
| "easy-ffi@2.0.0": | |
| 46, | |
| "easy-ffi@2.1.0": | |
| 52, | |
| "easy-ffi@2.1.2": | |
| 61, | |
| "easyimage@0.1.0": | |
| 144, | |
| "easyimage@0.2.0": | |
| 100, | |
| "easyimage@0.3.0": | |
| 99, | |
| "easyimage@1.0.0": | |
| 142, | |
| "ebyam@0.1.0": | |
| 52, | |
| "ebyam@0.1.1": | |
| 55, | |
| "ebyam@1.0.0": | |
| 64, | |
| "ebyam@1.2.0": | |
| 72, | |
| "echarts@0.4.0": | |
| 163, | |
| "echarts@0.4.1": | |
| 240, | |
| "echarts@0.5.0": | |
| 132, | |
| "echarts@0.6.0": | |
| 126, | |
| "echarts@0.7.0": | |
| 126, | |
| "echarts@1.0.0": | |
| 91, | |
| "echarts@1.0.1": | |
| 89, | |
| "echarts@2.0.0": | |
| -275, | |
| "echarts@3.0.0": | |
| 513, | |
| "echarts@3.0.1": | |
| 601, | |
| "echarts@3.1.0": | |
| 473, | |
| "echarts@3.2.0": | |
| 475, | |
| "echarts@4.0.0": | |
| 629, | |
| "echarts@4.0.1": | |
| 635, | |
| "echarts@4.0.2": | |
| 737, | |
| "echarts@4.1.0": | |
| 616, | |
| "echarts@5.0.0": | |
| 678, | |
| "echarts@6.0.0": | |
| 527, | |
| "echarts@6.1.0": | |
| 536, | |
| "echarts@7.0.0": | |
| 536, | |
| "echarts@7.0.1": | |
| 543, | |
| "echarts@8.0.0": | |
| 689, | |
| "echarts@8.0.1": | |
| 569, | |
| "echarts@9.0.0": | |
| 558, | |
| "echarts@9.1.0": | |
| 586, | |
| "echarts@10.0.0": | |
| 364, | |
| "echarts@10.1.0": | |
| 365, | |
| "eff@0.1.0": | |
| 66, | |
| "eff@0.1.1": | |
| 76, | |
| "eff@0.1.2": | |
| 120, | |
| "eff@1.0.0": | |
| 44, | |
| "eff@2.0.0": | |
| 52, | |
| "eff@3.0.0": | |
| 61, | |
| "eff@3.1.0": | |
| 66, | |
| "eff@3.2.0": | |
| 71, | |
| "eff@3.2.1": | |
| 75, | |
| "eff@3.2.2": | |
| 69, | |
| "eff@3.2.3": | |
| 72, | |
| "eff-functions@0.1.2": | |
| 123, | |
| "eff-functions@1.0.0": | |
| 43, | |
| "eff-functions@2.0.0": | |
| 52, | |
| "eff-object@0.0.0": | |
| 68, | |
| "eff-object@0.0.1": | |
| 74, | |
| "effect@0.1.0": | |
| 56, | |
| "effect@1.0.0": | |
| 71, | |
| "effect@1.1.0": | |
| 97, | |
| "effect@2.0.0": | |
| 102, | |
| "effect@2.0.1": | |
| 44, | |
| "effect@3.0.0": | |
| 51, | |
| "effect@4.0.0": | |
| 68, | |
| "effectful@1.0.0": | |
| 126, | |
| "either@0.1.0": | |
| 59, | |
| "either@0.1.1": | |
| 74, | |
| "either@0.1.2": | |
| 69, | |
| "either@0.1.3": | |
| 132, | |
| "either@0.1.4": | |
| 46, | |
| "either@0.1.5": | |
| 49, | |
| "either@0.1.6": | |
| 59, | |
| "either@0.1.7": | |
| 65, | |
| "either@0.1.8": | |
| 73, | |
| "either@0.2.0": | |
| 88, | |
| "either@0.2.1": | |
| 124, | |
| "either@0.2.2": | |
| 57, | |
| "either@0.2.3": | |
| 66, | |
| "either@1.0.0": | |
| 54, | |
| "either@2.0.0": | |
| 83, | |
| "either@2.1.0": | |
| 73, | |
| "either@2.2.0": | |
| 155, | |
| "either@2.2.1": | |
| 93, | |
| "either@3.0.0": | |
| 55, | |
| "either@3.1.0": | |
| 73, | |
| "either@3.2.0": | |
| 79, | |
| "either@4.0.0": | |
| 67, | |
| "either@4.1.0": | |
| 68, | |
| "either@4.1.1": | |
| 72, | |
| "either@5.0.0": | |
| 137, | |
| "either@6.0.0": | |
| 56, | |
| "either@6.1.0": | |
| 57, | |
| "either-extra@0.0.2": | |
| 64, | |
| "either-extra@0.0.3": | |
| 91, | |
| "either-extra@0.0.4": | |
| 79, | |
| "ejson@1.0.0": | |
| 112, | |
| "ejson@2.0.0": | |
| -458, | |
| "ejson@2.1.0": | |
| -351, | |
| "ejson@3.0.0": | |
| -340, | |
| "ejson@3.1.0": | |
| -358, | |
| "ejson@4.0.0": | |
| -376, | |
| "ejson@4.1.0": | |
| -372, | |
| "ejson@5.0.0": | |
| -501, | |
| "ejson@6.0.0": | |
| -606, | |
| "ejson@7.0.0": | |
| -479, | |
| "ejson@7.1.0": | |
| -472, | |
| "ejson@8.0.0": | |
| -487, | |
| "ejson@9.0.0": | |
| 767, | |
| "ejson@10.0.0": | |
| 1005, | |
| "ejson@10.0.1": | |
| 1110, | |
| "ejson@11.0.0": | |
| 244, | |
| "ejson@12.0.0": | |
| 357, | |
| "ejson@13.0.0": | |
| 112, | |
| "elasticsearch@0.1.0": | |
| 162, | |
| "elasticsearch@0.1.1": | |
| 162, | |
| "electron@0.0.1": | |
| 246, | |
| "electron@0.1.0": | |
| 69, | |
| "electron@0.1.1": | |
| 123, | |
| "electron@0.2.0": | |
| 107, | |
| "electron@0.2.1": | |
| 198, | |
| "electron@0.3.0": | |
| 245, | |
| "electron@0.3.1": | |
| 239, | |
| "electron@0.4.0": | |
| 239, | |
| "electron@0.5.0": | |
| 239, | |
| "electron@0.5.1": | |
| 246, | |
| "electron@0.6.0": | |
| 252, | |
| "electron@0.7.0": | |
| 345, | |
| "electron@1.0.0": | |
| 221, | |
| "electron@1.0.1": | |
| 239, | |
| "elm-color@0.1.0": | |
| 65, | |
| "elm-compat@0.0.0": | |
| 85, | |
| "elm-compat@1.0.0": | |
| 86, | |
| "elm-compat@2.0.0": | |
| 534, | |
| "elm-compat@2.0.1": | |
| 378, | |
| "elm-compat@3.0.0": | |
| 412, | |
| "elm-license-checker@1.0.0": | |
| 273, | |
| "elm-license-checker@2.0.0": | |
| 276, | |
| "elm-license-checker@2.1.0": | |
| 278, | |
| "elm-license-checker@2.2.0": | |
| 281, | |
| "elm-license-checker@2.2.1": | |
| 370, | |
| "elm-license-checker@2.3.0": | |
| 362, | |
| "elm-license-checker@2.4.0": | |
| 377, | |
| "elmish@0.0.1": | |
| 308, | |
| "elmish@0.0.2": | |
| 314, | |
| "elmish@0.0.3": | |
| 310, | |
| "elmish@0.0.4": | |
| 406, | |
| "elmish@0.0.5": | |
| 297, | |
| "elmish@0.1.0": | |
| 305, | |
| "elmish@0.1.1": | |
| 306, | |
| "elmish@0.1.2": | |
| 302, | |
| "elmish@0.1.3": | |
| 305, | |
| "elmish@0.1.4": | |
| 392, | |
| "elmish@0.1.5": | |
| 293, | |
| "elmish@0.1.6": | |
| 290, | |
| "elmish@0.2.0": | |
| 302, | |
| "elmish@0.2.1": | |
| 318, | |
| "elmish@0.2.2": | |
| 302, | |
| "elmish@0.3.0": | |
| 296, | |
| "elmish@0.3.1": | |
| 297, | |
| "elmish@0.3.2": | |
| 390, | |
| "elmish@0.4.0": | |
| -126, | |
| "elmish@0.5.0": | |
| 136, | |
| "elmish@0.5.1": | |
| 138, | |
| "elmish@0.5.2": | |
| 139, | |
| "elmish@0.5.3": | |
| 140, | |
| "elmish@0.5.4": | |
| 232, | |
| "elmish@0.5.5": | |
| 127, | |
| "elmish@0.5.6": | |
| 141, | |
| "elmish@0.5.7": | |
| 149, | |
| "elmish@0.5.8": | |
| 144, | |
| "elmish@0.6.0": | |
| 149, | |
| "elmish@0.7.0": | |
| 144, | |
| "elmish@0.8.0": | |
| 243, | |
| "elmish@0.8.1": | |
| 116, | |
| "elmish@0.8.2": | |
| 118, | |
| "elmish@0.8.3": | |
| 127, | |
| "elmish-enzyme@0.0.1": | |
| 150, | |
| "elmish-enzyme@0.0.2": | |
| 151, | |
| "elmish-enzyme@0.0.3": | |
| 235, | |
| "elmish-enzyme@0.1.0": | |
| 140, | |
| "elmish-enzyme@0.1.1": | |
| 122, | |
| "elmish-hooks@0.0.1": | |
| 146, | |
| "elmish-hooks@0.1.0": | |
| 142, | |
| "elmish-hooks@0.2.0": | |
| 153, | |
| "elmish-hooks@0.3.0": | |
| 154, | |
| "elmish-hooks@0.3.1": | |
| 150, | |
| "elmish-hooks@0.4.0": | |
| 293, | |
| "elmish-hooks@0.4.1": | |
| 132, | |
| "elmish-hooks@0.4.2": | |
| 137, | |
| "elmish-hooks@0.5.0": | |
| 144, | |
| "elmish-hooks@0.5.1": | |
| 142, | |
| "elmish-hooks@0.5.2": | |
| 143, | |
| "elmish-hooks@0.6.0": | |
| 149, | |
| "elmish-hooks@0.6.1": | |
| 145, | |
| "elmish-hooks@0.7.0": | |
| 234, | |
| "elmish-hooks@0.8.0": | |
| 136, | |
| "elmish-hooks@0.8.1": | |
| 230, | |
| "elmish-hooks@0.8.2": | |
| 228, | |
| "elmish-hooks@0.8.3": | |
| 126, | |
| "elmish-html@0.0.1": | |
| 526, | |
| "elmish-html@0.0.2": | |
| 423, | |
| "elmish-html@0.0.3": | |
| 439, | |
| "elmish-html@0.0.4": | |
| 352, | |
| "elmish-html@0.1.0": | |
| 357, | |
| "elmish-html@0.1.1": | |
| 456, | |
| "elmish-html@0.1.2": | |
| 348, | |
| "elmish-html@0.1.3": | |
| 348, | |
| "elmish-html@0.1.4": | |
| 363, | |
| "elmish-html@0.2.0": | |
| 333, | |
| "elmish-html@0.3.0": | |
| 184, | |
| "elmish-html@0.3.1": | |
| 183, | |
| "elmish-html@0.4.0": | |
| 167, | |
| "elmish-html@0.5.0": | |
| 273, | |
| "elmish-html@0.6.0": | |
| 151, | |
| "elmish-html@0.7.0": | |
| 162, | |
| "elmish-html@0.7.1": | |
| 231, | |
| "elmish-html@0.7.2": | |
| 144, | |
| "elmish-testing-library@0.1.0": | |
| 265, | |
| "elmish-testing-library@0.1.1": | |
| 396, | |
| "elmish-testing-library@0.1.2": | |
| 267, | |
| "elmish-testing-library@0.1.3": | |
| 257, | |
| "elmish-testing-library@0.1.4": | |
| 263, | |
| "elmish-testing-library@0.1.5": | |
| 265, | |
| "elmish-testing-library@0.1.6": | |
| 266, | |
| "elmish-testing-library@0.2.0": | |
| 268, | |
| "elmish-testing-library@0.3.0": | |
| 219, | |
| "elmish-testing-library@0.3.1": | |
| 118, | |
| "email-validate@0.0.0": | |
| 79, | |
| "email-validate@1.0.1": | |
| 92, | |
| "email-validate@1.0.2": | |
| 88, | |
| "email-validate@1.0.3": | |
| 95, | |
| "email-validate@1.0.4": | |
| 92, | |
| "email-validate@1.0.5": | |
| 93, | |
| "email-validate@1.0.6": | |
| 170, | |
| "email-validate@1.0.7": | |
| 426, | |
| "email-validate@2.0.0": | |
| 362, | |
| "email-validate@3.0.0": | |
| 208, | |
| "email-validate@3.0.1": | |
| 208, | |
| "email-validate@4.0.0": | |
| 211, | |
| "email-validate@5.0.0": | |
| 209, | |
| "email-validate@6.0.0": | |
| 116, | |
| "email-validate@7.0.0": | |
| 213, | |
| "emmet@1.0.2": | |
| 467, | |
| "emmet@1.0.3": | |
| 225, | |
| "emmet@1.0.4": | |
| 231, | |
| "emo8@0.1.0": | |
| 648, | |
| "emo8@0.2.0": | |
| 651, | |
| "emo8@0.3.0": | |
| 794, | |
| "emo8@0.4.0": | |
| 628, | |
| "emo8@0.5.0": | |
| 594, | |
| "emo8@0.5.1": | |
| 594, | |
| "emo8@0.6.0": | |
| 656, | |
| "emo8@0.7.0": | |
| 368, | |
| "emo8@0.7.1": | |
| 456, | |
| "emoji-splitter@0.1.0": | |
| 116, | |
| "emoji-splitter@0.2.0": | |
| 114, | |
| "emoji-splitter@0.2.1": | |
| 124, | |
| "encoding@0.0.1": | |
| 66, | |
| "encoding@0.0.2": | |
| 72, | |
| "encoding@0.0.3": | |
| 74, | |
| "encoding@0.0.4": | |
| 81, | |
| "encoding@0.0.5": | |
| 151, | |
| "encoding@0.0.6": | |
| 82, | |
| "encoding@0.0.7": | |
| 49, | |
| "encoding@0.0.8": | |
| 75, | |
| "enums@0.2.2": | |
| 71, | |
| "enums@0.2.3": | |
| 70, | |
| "enums@0.2.4": | |
| 77, | |
| "enums@0.3.0": | |
| -72, | |
| "enums@0.3.1": | |
| -120, | |
| "enums@0.4.0": | |
| 100, | |
| "enums@0.5.0": | |
| 59, | |
| "enums@0.6.0": | |
| 81, | |
| "enums@0.7.0": | |
| 74, | |
| "enums@1.0.0": | |
| 65, | |
| "enums@1.1.0": | |
| 67, | |
| "enums@2.0.0": | |
| 84, | |
| "enums@2.0.1": | |
| 152, | |
| "enums@3.0.0": | |
| 183, | |
| "enums@3.1.0": | |
| 182, | |
| "enums@3.2.0": | |
| 193, | |
| "enums@3.2.1": | |
| 191, | |
| "enums@4.0.0": | |
| 89, | |
| "enums@4.0.1": | |
| 88, | |
| "enums@5.0.0": | |
| 85, | |
| "enums@6.0.0": | |
| 142, | |
| "enums@6.0.1": | |
| 76, | |
| "envparse@1.0.1": | |
| 99, | |
| "enzyme@0.0.1": | |
| 758, | |
| "enzyme@0.1.0": | |
| 736, | |
| "enzyme@0.1.1": | |
| 733, | |
| "enzyme@0.2.0": | |
| 732, | |
| "enzyme@0.3.0": | |
| 850, | |
| "enzyme@0.4.0": | |
| 716, | |
| "enzyme@0.5.0": | |
| 718, | |
| "enzyme@0.6.0": | |
| 731, | |
| "enzyme@0.6.1": | |
| 745, | |
| "enzyme@0.7.0": | |
| 733, | |
| "enzyme@0.7.1": | |
| 730, | |
| "enzyme@0.8.0": | |
| 844, | |
| "equatable-functions@1.0.0": | |
| 44, | |
| "equatable-functions@1.0.1": | |
| 56, | |
| "equatable-functions@1.0.2": | |
| 69, | |
| "equatable-functions@1.0.3": | |
| 68, | |
| "erlps-core@0.0.1": | |
| 364, | |
| "erlps-core@0.0.2": | |
| 357, | |
| "erlps-core@0.0.3": | |
| 362, | |
| "erlps-core@0.0.4": | |
| 485, | |
| "error@1.0.1": | |
| 41, | |
| "error@1.0.2": | |
| 63, | |
| "error@2.0.0": | |
| 83, | |
| "errors@0.1.0": | |
| 83, | |
| "errors@0.1.1": | |
| 78, | |
| "errors@0.1.2": | |
| 79, | |
| "errors@0.1.3": | |
| 136, | |
| "errors@0.1.4": | |
| 69, | |
| "errors@0.2.0": | |
| 79, | |
| "errors@0.3.0": | |
| 78, | |
| "errors@1.0.0": | |
| 71, | |
| "errors@2.0.0": | |
| 119, | |
| "errors@2.1.0": | |
| 208, | |
| "errors@2.2.0": | |
| 91, | |
| "errors@2.3.0": | |
| 91, | |
| "errors@2.4.0": | |
| 103, | |
| "errors@3.0.0": | |
| 154, | |
| "errors@4.0.0": | |
| 89, | |
| "errors@4.0.1": | |
| 90, | |
| "errors@4.1.0": | |
| 90, | |
| "es6-symbols@1.0.0": | |
| 123, | |
| "es6-symbols@1.0.1": | |
| 57, | |
| "es6-symbols@1.0.2": | |
| 89, | |
| "eth-core@0.0.1": | |
| -465, | |
| "eth-core@0.1.0": | |
| -434, | |
| "eth-core@1.0.0": | |
| 498, | |
| "eth-core@1.1.0": | |
| 639, | |
| "eth-core@2.0.0": | |
| 476, | |
| "eth-core@3.0.0": | |
| 409, | |
| "eth-core@4.0.0": | |
| 451, | |
| "eth-core@5.0.0": | |
| 430, | |
| "ethereum@0.1.0": | |
| 281, | |
| "ethereum@0.2.1": | |
| 284, | |
| "ethereum@0.2.2": | |
| 406, | |
| "ethereum@0.2.3": | |
| 268, | |
| "ethereum@0.2.4": | |
| 275, | |
| "ethereum@0.2.5": | |
| 282, | |
| "ethereum@0.2.6": | |
| 282, | |
| "ethereum@0.2.7": | |
| 284, | |
| "ethereum@0.2.8": | |
| 284, | |
| "ethereum@0.2.9": | |
| 369, | |
| "ethereum@0.2.10": | |
| 273, | |
| "ethereum-client@0.1.0": | |
| 996, | |
| "eulalie@1.0.0": | |
| 88, | |
| "eulalie@2.0.0": | |
| 73, | |
| "eulalie@3.0.0": | |
| 75, | |
| "eulalie@4.0.0": | |
| -186, | |
| "eulalie@4.1.0": | |
| 201, | |
| "eulalie@5.0.0": | |
| 336, | |
| "eval@1.0.0": | |
| 43, | |
| "eval@1.0.1": | |
| 65, | |
| "eval@1.1.0": | |
| 59, | |
| "event@1.0.0": | |
| 198, | |
| "event@1.1.0": | |
| 205, | |
| "event@1.2.0": | |
| 332, | |
| "event@1.2.1": | |
| 240, | |
| "event@1.2.2": | |
| 235, | |
| "event@1.2.3": | |
| 248, | |
| "event@1.2.4": | |
| 251, | |
| "event@1.3.0": | |
| 249, | |
| "exceptions@0.1.0": | |
| 63, | |
| "exceptions@0.2.0": | |
| 64, | |
| "exceptions@0.2.1": | |
| 140, | |
| "exceptions@0.2.2": | |
| 52, | |
| "exceptions@0.2.3": | |
| 56, | |
| "exceptions@0.3.0": | |
| 68, | |
| "exceptions@0.3.1": | |
| 69, | |
| "exceptions@0.3.2": | |
| 65, | |
| "exceptions@0.3.3": | |
| 61, | |
| "exceptions@0.3.4": | |
| 155, | |
| "exceptions@1.0.0": | |
| 59, | |
| "exceptions@2.0.0": | |
| 64, | |
| "exceptions@3.0.0": | |
| 87, | |
| "exceptions@3.1.0": | |
| 83, | |
| "exceptions@4.0.0": | |
| 73, | |
| "exceptions@5.0.0": | |
| 73, | |
| "exceptions@6.0.0": | |
| 72, | |
| "exists@0.1.0": | |
| 90, | |
| "exists@0.1.1": | |
| 107, | |
| "exists@0.2.0": | |
| 45, | |
| "exists@1.0.0": | |
| 73, | |
| "exists@2.0.0": | |
| 67, | |
| "exists@3.0.0": | |
| 61, | |
| "exists@4.0.0": | |
| 73, | |
| "exists@5.0.0": | |
| 67, | |
| "exists@5.1.0": | |
| 63, | |
| "exists@6.0.0": | |
| 133, | |
| "exists-eq@1.0.0": | |
| 49, | |
| "exists-eq@1.0.1": | |
| 62, | |
| "exists-eq@1.0.2": | |
| 67, | |
| "exists-eq@1.0.3": | |
| 69, | |
| "exitcodes@1.0.0": | |
| 71, | |
| "exitcodes@2.0.0": | |
| 112, | |
| "exitcodes@3.0.0": | |
| 460, | |
| "exitcodes@4.0.0": | |
| 74, | |
| "expect-inferred@0.1.0": | |
| 52, | |
| "expect-inferred@0.2.0": | |
| 69, | |
| "expect-inferred@1.0.0": | |
| 66, | |
| "expect-inferred@2.0.0": | |
| 66, | |
| "expect-inferred@3.0.0": | |
| 129, | |
| "express@0.1.5": | |
| -85, | |
| "express@0.2.0": | |
| 88, | |
| "express@0.3.0": | |
| 117, | |
| "express@0.3.1": | |
| 106, | |
| "express@0.3.2": | |
| 100, | |
| "express@0.3.3": | |
| 92, | |
| "express@0.4.0": | |
| 188, | |
| "express@0.4.1": | |
| 381, | |
| "express@0.4.2": | |
| 358, | |
| "express@0.4.3": | |
| 367, | |
| "express@0.5.0": | |
| 407, | |
| "express@0.5.1": | |
| 618, | |
| "express@0.5.2": | |
| 704, | |
| "express@0.6.0": | |
| 496, | |
| "express@0.6.1": | |
| 504, | |
| "express@0.6.2": | |
| 508, | |
| "express@0.6.3": | |
| 517, | |
| "express@0.6.4": | |
| 516, | |
| "express@0.7.0": | |
| 373, | |
| "express@0.7.1": | |
| 637, | |
| "express@0.8.0": | |
| 521, | |
| "express@0.9.0": | |
| 194, | |
| "express-passport@0.0.2": | |
| -463, | |
| "express-passport@0.0.4": | |
| -464, | |
| "express-passport@0.0.5": | |
| 914, | |
| "extensions@1.0.0": | |
| 83, | |
| "extensions@1.0.1": | |
| 113, | |
| "extensions@1.0.2": | |
| 49, | |
| "extensions@1.0.3": | |
| 75, | |
| "extensions@1.0.4": | |
| 72, | |
| "extensions@1.0.5": | |
| 70, | |
| "extensions@1.1.0": | |
| 158, | |
| "extensions@1.2.0": | |
| 189, | |
| "extensions@1.2.1": | |
| 171, | |
| "extensions@1.2.2": | |
| 283, | |
| "extensions@2.0.0": | |
| 221, | |
| "extensions@2.1.0": | |
| 205, | |
| "extensions@2.1.1": | |
| 212, | |
| "extensions@2.1.2": | |
| 212, | |
| "extensions@2.1.3": | |
| 217, | |
| "extensions@2.1.4": | |
| 210, | |
| "extensions@2.1.5": | |
| 378, | |
| "extensions@2.1.6": | |
| 269, | |
| "extensions@2.2.0": | |
| 267, | |
| "extensions@2.2.1": | |
| 278, | |
| "extensions@2.2.2": | |
| 274, | |
| "extensions@2.3.0": | |
| 275, | |
| "extensions@2.3.1": | |
| 399, | |
| "extensions@2.3.2": | |
| 266, | |
| "extensions@2.3.3": | |
| 265, | |
| "extensions@2.3.4": | |
| 274, | |
| "extensions@2.3.5": | |
| 275, | |
| "extensions@2.3.6": | |
| 274, | |
| "extensions@2.3.7": | |
| 278, | |
| "extensions@2.3.8": | |
| 404, | |
| "externs-check@0.1.0": | |
| 1192, | |
| "externs-check@0.1.1": | |
| 1204, | |
| "externs-check@0.2.0": | |
| 837, | |
| "externs-check@0.2.1": | |
| 842, | |
| "externs-check@1.0.0": | |
| 812, | |
| "externs-check@2.0.0": | |
| 324, | |
| "externs-check@2.0.1": | |
| 436, | |
| "facebook@0.0.1": | |
| 385, | |
| "facebook@0.1.0": | |
| 403, | |
| "facebook@0.2.0": | |
| 436, | |
| "facebook@0.2.1": | |
| 380, | |
| "facebook@0.2.2": | |
| 379, | |
| "facebook@0.2.3": | |
| 492, | |
| "facebook@0.3.0": | |
| 308, | |
| "fahrtwind@1.0.1": | |
| 126, | |
| "fallback@0.1.0": | |
| 77, | |
| "fancy-operators@1.0.0": | |
| 61, | |
| "fast-vect@0.1.0": | |
| 196, | |
| "fast-vect@0.1.1": | |
| 302, | |
| "fast-vect@0.1.2": | |
| 71, | |
| "fast-vect@0.2.0": | |
| 79, | |
| "fast-vect@0.3.0": | |
| 188, | |
| "fast-vect@0.3.1": | |
| 87, | |
| "fast-vect@0.5.0": | |
| 184, | |
| "fast-vect@0.5.1": | |
| 100, | |
| "fast-vect@0.6.0": | |
| 163, | |
| "fast-vect@0.6.2": | |
| 71, | |
| "fast-vect@0.7.0": | |
| 83, | |
| "fast-vect@1.0.0": | |
| 93, | |
| "fetch@1.0.0": | |
| 127, | |
| "fetch@1.0.1": | |
| 129, | |
| "fetch@1.1.0": | |
| 127, | |
| "fetch@1.1.1": | |
| 252, | |
| "fetch@1.1.2": | |
| 115, | |
| "fetch@1.1.3": | |
| 115, | |
| "fetch@1.1.4": | |
| 128, | |
| "fetch-api@1.0.0": | |
| 412, | |
| "fetch-argonaut@1.0.0": | |
| 123, | |
| "fetch-core@4.0.3": | |
| 115, | |
| "fetch-core@4.0.4": | |
| 116, | |
| "fetch-free@0.1.0": | |
| 589, | |
| "fetch-free@0.1.1": | |
| 433, | |
| "fetch-yoga-json@1.0.1": | |
| 96, | |
| "fetch-yoga-json@1.1.0": | |
| 116, | |
| "ffi-foreign@0.0.1": | |
| 177, | |
| "ffi-foreign@0.0.2": | |
| 179, | |
| "ffi-props@0.1.0": | |
| 66, | |
| "ffi-utils@1.0.0": | |
| 347, | |
| "ffi-utils@1.1.0": | |
| 218, | |
| "ffi-utils@1.2.0": | |
| 219, | |
| "ffi-utils@1.3.0": | |
| 231, | |
| "ffi-utils@1.4.0": | |
| 233, | |
| "ffi-utils@2.0.0": | |
| 373, | |
| "ffi-utils@2.0.1": | |
| 369, | |
| "ffi-utils@3.0.0": | |
| 393, | |
| "ffi-utils@4.0.0": | |
| 510, | |
| "filterable@0.1.0": | |
| 47, | |
| "filterable@0.1.1": | |
| 62, | |
| "filterable@0.1.2": | |
| 74, | |
| "filterable@0.1.3": | |
| 61, | |
| "filterable@1.0.0": | |
| 103, | |
| "filterable@1.1.0": | |
| 161, | |
| "filterable@2.0.0": | |
| 133, | |
| "filterable@2.0.1": | |
| 106, | |
| "filterable@2.1.0": | |
| 173, | |
| "filterable@2.2.0": | |
| 534, | |
| "filterable@2.3.0": | |
| 207, | |
| "filterable@2.4.0": | |
| 205, | |
| "filterable@2.4.1": | |
| 208, | |
| "filterable@3.0.0": | |
| 242, | |
| "filterable@3.0.1": | |
| 121, | |
| "filterable@3.0.2": | |
| 122, | |
| "filterable@4.0.0": | |
| 98, | |
| "filterable@4.0.1": | |
| 98, | |
| "filterable@5.0.0": | |
| 83, | |
| "filterables@0.1.0": | |
| 507, | |
| "firebase@3.0.0": | |
| -461, | |
| "firebase@4.0.0": | |
| -546, | |
| "firebase-client@0.0.1": | |
| -180, | |
| "firebase-client@1.0.0": | |
| -202, | |
| "firebase-client@1.1.0": | |
| -203, | |
| "fixed-points@0.1.0": | |
| 64, | |
| "fixed-points@0.2.0": | |
| 124, | |
| "fixed-points@1.0.0": | |
| 50, | |
| "fixed-points@2.0.0": | |
| 57, | |
| "fixed-points@3.0.0": | |
| 74, | |
| "fixed-points@4.0.0": | |
| 213, | |
| "fixed-points@5.0.0": | |
| 91, | |
| "fixed-points@5.1.0": | |
| 90, | |
| "fixed-points@6.0.0": | |
| 163, | |
| "fixed-points@7.0.0": | |
| 181, | |
| "fixed-precision@1.0.0": | |
| 286, | |
| "fixed-precision@2.0.0": | |
| 265, | |
| "fixed-precision@3.0.0": | |
| 147, | |
| "fixed-precision@3.0.1": | |
| 140, | |
| "fixed-precision@4.0.0": | |
| 125, | |
| "fixed-precision@4.0.1": | |
| 126, | |
| "fixed-precision@4.1.0": | |
| 238, | |
| "fixed-precision@4.2.0": | |
| 117, | |
| "fixed-precision@4.3.0": | |
| 111, | |
| "fixed-precision@4.3.1": | |
| 129, | |
| "fixed-precision@5.0.0": | |
| 95, | |
| "flame@0.0.1": | |
| 311, | |
| "flame@0.2.0": | |
| 312, | |
| "flame@0.3.0": | |
| 310, | |
| "flame@0.3.1": | |
| 438, | |
| "flame@0.4.0": | |
| 295, | |
| "flame@0.4.1": | |
| 309, | |
| "flame@0.4.2": | |
| 306, | |
| "flame@0.4.3": | |
| 317, | |
| "flame@0.4.4": | |
| 307, | |
| "flame@0.4.5": | |
| 432, | |
| "flame@0.5.0": | |
| 292, | |
| "flame@0.5.1": | |
| 357, | |
| "flame@0.5.2": | |
| 370, | |
| "flame@0.5.3": | |
| 367, | |
| "flame@0.5.4": | |
| 368, | |
| "flame@0.6.0": | |
| 452, | |
| "flame@0.6.1": | |
| 357, | |
| "flame@0.6.2": | |
| 352, | |
| "flame@0.6.3": | |
| 354, | |
| "flame@0.7.0": | |
| 356, | |
| "flame@1.0.0": | |
| 345, | |
| "flame@1.1.0": | |
| 154, | |
| "flame@1.1.1": | |
| 146, | |
| "flame@1.1.2": | |
| 239, | |
| "flame@1.2.0": | |
| 145, | |
| "flare@0.1.0": | |
| 108, | |
| "flare@0.1.1": | |
| 109, | |
| "flare@0.1.2": | |
| 112, | |
| "flare@0.1.3": | |
| 110, | |
| "flare@0.1.4": | |
| 204, | |
| "flare@0.1.5": | |
| 99, | |
| "flare@0.1.6": | |
| 101, | |
| "flare@0.1.7": | |
| 112, | |
| "flare@0.2.0": | |
| -105, | |
| "flare@0.2.1": | |
| -104, | |
| "flare@0.3.0": | |
| -102, | |
| "flare@0.4.0": | |
| -192, | |
| "flare@0.4.1": | |
| -95, | |
| "flare@0.4.2": | |
| -99, | |
| "flare@0.4.3": | |
| -104, | |
| "flare@0.5.0": | |
| -114, | |
| "flare@0.5.1": | |
| -113, | |
| "flare@1.0.0": | |
| 180, | |
| "flare@1.0.1": | |
| 82, | |
| "flare@1.1.0": | |
| -207, | |
| "flare@2.0.0": | |
| -470, | |
| "flare@2.0.1": | |
| -468, | |
| "flare@3.0.0": | |
| 469, | |
| "flare@3.1.0": | |
| 602, | |
| "flare@3.2.0": | |
| 450, | |
| "flare@4.0.0": | |
| 559, | |
| "flare@4.1.0": | |
| 551, | |
| "flare@5.0.0": | |
| 283, | |
| "flare@6.0.0": | |
| 273, | |
| "flaredoc@4.0.0": | |
| 1852, | |
| "flatpickr@0.1.0": | |
| -286, | |
| "flatpickr@1.0.0": | |
| 672, | |
| "float32@0.0.0": | |
| 101, | |
| "float32@0.0.1": | |
| 101, | |
| "float32@0.0.2": | |
| 190, | |
| "float32@0.1.0": | |
| 88, | |
| "float32@0.1.1": | |
| 97, | |
| "float32@0.2.0": | |
| 100, | |
| "float32@1.0.0": | |
| 85, | |
| "float32@2.0.0": | |
| 78, | |
| "flow-id@0.1.1": | |
| 229, | |
| "flow-id@0.1.2": | |
| 326, | |
| "flow-id@1.0.0": | |
| 238, | |
| "foldable-traversable@0.1.6": | |
| 52, | |
| "foldable-traversable@0.2.0": | |
| 77, | |
| "foldable-traversable@0.2.1": | |
| 69, | |
| "foldable-traversable@0.3.0": | |
| 77, | |
| "foldable-traversable@0.3.1": | |
| 72, | |
| "foldable-traversable@0.4.0": | |
| 133, | |
| "foldable-traversable@0.4.1": | |
| 65, | |
| "foldable-traversable@0.4.2": | |
| 65, | |
| "foldable-traversable@1.0.0": | |
| 69, | |
| "foldable-traversable@2.0.0": | |
| 74, | |
| "foldable-traversable@2.1.0": | |
| 75, | |
| "foldable-traversable@2.2.0": | |
| 75, | |
| "foldable-traversable@3.0.0": | |
| 121, | |
| "foldable-traversable@3.1.0": | |
| 49, | |
| "foldable-traversable@3.2.0": | |
| 77, | |
| "foldable-traversable@3.3.0": | |
| 69, | |
| "foldable-traversable@3.3.1": | |
| 74, | |
| "foldable-traversable@3.4.0": | |
| 71, | |
| "foldable-traversable@3.5.0": | |
| 111, | |
| "foldable-traversable@3.6.0": | |
| 57, | |
| "foldable-traversable@3.6.1": | |
| 71, | |
| "foldable-traversable@3.7.0": | |
| 72, | |
| "foldable-traversable@3.7.1": | |
| 71, | |
| "foldable-traversable@4.0.0": | |
| 90, | |
| "foldable-traversable@4.0.1": | |
| 123, | |
| "foldable-traversable@4.1.0": | |
| 47, | |
| "foldable-traversable@4.1.1": | |
| 73, | |
| "foldable-traversable@5.0.0": | |
| 80, | |
| "foldable-traversable@5.0.1": | |
| 79, | |
| "foldable-traversable@6.0.0": | |
| 72, | |
| "folds@1.0.1": | |
| 71, | |
| "folds@2.0.0": | |
| 86, | |
| "folds@3.0.0": | |
| 213, | |
| "folds@3.1.0": | |
| 112, | |
| "folds@4.0.0": | |
| 71, | |
| "folds@5.0.0": | |
| 114, | |
| "folds@5.1.0": | |
| 108, | |
| "folds@5.2.0": | |
| 106, | |
| "foreign@0.3.0": | |
| 76, | |
| "foreign@0.4.0": | |
| 151, | |
| "foreign@0.4.1": | |
| 75, | |
| "foreign@0.4.2": | |
| 51, | |
| "foreign@0.5.0": | |
| 83, | |
| "foreign@0.5.1": | |
| 80, | |
| "foreign@0.6.0": | |
| 83, | |
| "foreign@0.7.0": | |
| 84, | |
| "foreign@0.7.1": | |
| 78, | |
| "foreign@0.7.2": | |
| 149, | |
| "foreign@1.0.0": | |
| 84, | |
| "foreign@1.1.0": | |
| 47, | |
| "foreign@2.0.0": | |
| 138, | |
| "foreign@3.0.0": | |
| 174, | |
| "foreign@3.0.1": | |
| 154, | |
| "foreign@3.1.0": | |
| 165, | |
| "foreign@3.2.0": | |
| 151, | |
| "foreign@4.0.0": | |
| 290, | |
| "foreign@4.0.1": | |
| 217, | |
| "foreign@5.0.0": | |
| 123, | |
| "foreign@6.0.0": | |
| 101, | |
| "foreign@6.0.1": | |
| 100, | |
| "foreign@7.0.0": | |
| 90, | |
| "foreign-clone@0.0.1": | |
| 178, | |
| "foreign-datetime@0.1.0": | |
| 200, | |
| "foreign-datetime@1.0.0": | |
| 322, | |
| "foreign-datetime@2.0.0": | |
| 283, | |
| "foreign-datetime@2.0.1": | |
| 536, | |
| "foreign-datetime@3.0.0": | |
| 388, | |
| "foreign-extra@0.3.0": | |
| 76, | |
| "foreign-extra@0.4.0": | |
| 84, | |
| "foreign-extra@0.4.1": | |
| 74, | |
| "foreign-extra@0.4.2": | |
| 134, | |
| "foreign-extra@0.5.0": | |
| 74, | |
| "foreign-extra@0.5.1": | |
| 57, | |
| "foreign-extra@0.6.0": | |
| 85, | |
| "foreign-extra@0.7.0": | |
| 87, | |
| "foreign-extra@0.7.1": | |
| 77, | |
| "foreign-extra@0.7.2": | |
| 78, | |
| "foreign-generic@1.0.1": | |
| 78, | |
| "foreign-generic@2.0.0": | |
| 323, | |
| "foreign-generic@3.0.0": | |
| 189, | |
| "foreign-generic@4.0.0": | |
| 216, | |
| "foreign-generic@4.1.0": | |
| 308, | |
| "foreign-generic@4.2.0": | |
| 269, | |
| "foreign-generic@4.3.0": | |
| 259, | |
| "foreign-generic@5.0.0": | |
| 266, | |
| "foreign-generic@5.0.1": | |
| 257, | |
| "foreign-generic@6.0.0": | |
| 372, | |
| "foreign-generic@7.0.0": | |
| 141, | |
| "foreign-generic@8.0.0": | |
| 146, | |
| "foreign-generic@8.1.0": | |
| 185, | |
| "foreign-generic@9.0.0": | |
| 162, | |
| "foreign-generic@10.0.0": | |
| 163, | |
| "foreign-generic@11.0.0": | |
| 112, | |
| "foreign-lens@1.0.1": | |
| 168, | |
| "foreign-lens@2.0.0": | |
| 365, | |
| "foreign-lens@3.0.0": | |
| 405, | |
| "foreign-object@1.0.0": | |
| 102, | |
| "foreign-object@1.1.0": | |
| 101, | |
| "foreign-object@2.0.0": | |
| 102, | |
| "foreign-object@2.0.1": | |
| 198, | |
| "foreign-object@2.0.2": | |
| 107, | |
| "foreign-object@2.0.3": | |
| 86, | |
| "foreign-object@3.0.0": | |
| 93, | |
| "foreign-object@4.0.0": | |
| 91, | |
| "foreign-object@4.1.0": | |
| 83, | |
| "foreign-readwrite@1.0.1": | |
| 114, | |
| "foreign-readwrite@1.0.2": | |
| 115, | |
| "foreign-readwrite@2.0.0": | |
| 214, | |
| "foreign-readwrite@3.0.0": | |
| 92, | |
| "foreign-readwrite@3.1.0": | |
| 100, | |
| "foreign-readwrite@3.2.0": | |
| 94, | |
| "foreign-readwrite@3.2.1": | |
| 104, | |
| "fork@1.0.0": | |
| -119, | |
| "fork@1.1.0": | |
| 205, | |
| "fork@2.0.0": | |
| 271, | |
| "fork@3.0.0": | |
| 579, | |
| "fork@4.0.0": | |
| 289, | |
| "fork@5.0.0": | |
| 125, | |
| "fork@6.0.0": | |
| 112, | |
| "form-decoder@0.0.0": | |
| 73, | |
| "form-decoder@0.0.1": | |
| 78, | |
| "form-decoder@0.0.2": | |
| 74, | |
| "form-decoder@0.0.3": | |
| 77, | |
| "form-urlencoded@0.2.0": | |
| 272, | |
| "form-urlencoded@0.2.1": | |
| 143, | |
| "form-urlencoded@0.3.0": | |
| 57, | |
| "form-urlencoded@0.3.1": | |
| 83, | |
| "form-urlencoded@1.0.0": | |
| 68, | |
| "form-urlencoded@2.0.0": | |
| 122, | |
| "form-urlencoded@3.0.0": | |
| 203, | |
| "form-urlencoded@4.0.0": | |
| 119, | |
| "form-urlencoded@4.0.1": | |
| 225, | |
| "form-urlencoded@5.0.0": | |
| 96, | |
| "form-urlencoded@6.0.0": | |
| 80, | |
| "form-urlencoded@6.0.1": | |
| 96, | |
| "form-urlencoded@6.0.2": | |
| 94, | |
| "form-urlencoded@7.0.0": | |
| 87, | |
| "format@0.1.0": | |
| 73, | |
| "format@0.1.1": | |
| 143, | |
| "format@1.0.0": | |
| 90, | |
| "format@1.0.1": | |
| 51, | |
| "format@2.0.0": | |
| 124, | |
| "format@2.1.0": | |
| 101, | |
| "format@3.0.0": | |
| 156, | |
| "format@4.0.0": | |
| 129, | |
| "format-nix@0.1.0": | |
| 236, | |
| "format-nix@0.1.1": | |
| 232, | |
| "format-nix@0.2.0": | |
| 135, | |
| "format-nix@0.3.0": | |
| 146, | |
| "formatters@0.0.1": | |
| 73, | |
| "formatters@0.0.2": | |
| 79, | |
| "formatters@0.0.3": | |
| 145, | |
| "formatters@0.0.4": | |
| 60, | |
| "formatters@0.0.5": | |
| 73, | |
| "formatters@0.1.0": | |
| -201, | |
| "formatters@0.1.1": | |
| 225, | |
| "formatters@0.1.2": | |
| 219, | |
| "formatters@0.1.3": | |
| 219, | |
| "formatters@0.2.0": | |
| 280, | |
| "formatters@0.3.0": | |
| 178, | |
| "formatters@0.3.1": | |
| 183, | |
| "formatters@0.4.0": | |
| 190, | |
| "formatters@1.0.0": | |
| 263, | |
| "formatters@1.0.1": | |
| 483, | |
| "formatters@2.0.0": | |
| 447, | |
| "formatters@2.0.1": | |
| 395, | |
| "formatters@2.0.2": | |
| 298, | |
| "formatters@2.1.0": | |
| 313, | |
| "formatters@3.0.0": | |
| 312, | |
| "formatters@3.0.1": | |
| 312, | |
| "formatters@3.0.2": | |
| 312, | |
| "formatters@4.0.0": | |
| 297, | |
| "formatters@4.0.1": | |
| 204, | |
| "formatters@5.0.0": | |
| 104, | |
| "formatters@5.0.1": | |
| 116, | |
| "formatters@6.0.0": | |
| 118, | |
| "formatters@7.0.0": | |
| 102, | |
| "formatting@1.0.0": | |
| 59, | |
| "formatting@1.0.1": | |
| 70, | |
| "formatting@1.0.2": | |
| 95, | |
| "formatting@1.0.3": | |
| 110, | |
| "formatting@1.0.4": | |
| 38, | |
| "formatting@1.0.5": | |
| 64, | |
| "formless-aj@0.1.0": | |
| 245, | |
| "framer-motion@0.0.2": | |
| 198, | |
| "framer-motion@0.0.3": | |
| 195, | |
| "framer-motion@0.0.5": | |
| 202, | |
| "framer-motion@0.0.6": | |
| 297, | |
| "framer-motion@0.1.0": | |
| 183, | |
| "framer-motion@1.0.1": | |
| -147, | |
| "free@0.0.8": | |
| -66, | |
| "free@0.1.4": | |
| 82, | |
| "free@0.1.5": | |
| 73, | |
| "free@0.1.6": | |
| 76, | |
| "free@0.2.0": | |
| 76, | |
| "free@0.3.0": | |
| 170, | |
| "free@0.4.0": | |
| 91, | |
| "free@0.4.1": | |
| 69, | |
| "free@0.4.2": | |
| 88, | |
| "free@0.5.0": | |
| 91, | |
| "free@0.5.1": | |
| 91, | |
| "free@0.6.0": | |
| 90, | |
| "free@0.6.1": | |
| 92, | |
| "free@0.7.0": | |
| 181, | |
| "free@0.8.0": | |
| 94, | |
| "free@0.9.0": | |
| 71, | |
| "free@0.9.1": | |
| 93, | |
| "free@1.0.0": | |
| 76, | |
| "free@1.1.0": | |
| 81, | |
| "free@1.2.0": | |
| 75, | |
| "free@1.3.0": | |
| 80, | |
| "free@1.4.0": | |
| 145, | |
| "free@2.0.0": | |
| -115, | |
| "free@3.0.0": | |
| 202, | |
| "free@3.0.1": | |
| 181, | |
| "free@3.1.0": | |
| -167, | |
| "free@3.2.0": | |
| 181, | |
| "free@3.3.0": | |
| -164, | |
| "free@3.4.0": | |
| 187, | |
| "free@3.5.0": | |
| 308, | |
| "free@3.5.1": | |
| 173, | |
| "free@4.0.0": | |
| 214, | |
| "free@4.0.1": | |
| 194, | |
| "free@4.1.0": | |
| 205, | |
| "free@4.2.0": | |
| 195, | |
| "free@4.3.0": | |
| 197, | |
| "free@5.0.0": | |
| 195, | |
| "free@5.1.0": | |
| 101, | |
| "free@5.2.0": | |
| 93, | |
| "free@6.0.0": | |
| 82, | |
| "free@6.0.1": | |
| 87, | |
| "free@6.1.0": | |
| 87, | |
| "free@6.2.0": | |
| 86, | |
| "free@7.0.0": | |
| 82, | |
| "free-alt@0.1.0": | |
| 255, | |
| "free-alt@0.2.0": | |
| 155, | |
| "free-alternative@0.1.0": | |
| 165, | |
| "free-alternative@0.2.0": | |
| 181, | |
| "free-canvas@0.2.0": | |
| 94, | |
| "free-canvas@0.3.0": | |
| 92, | |
| "free-canvas@0.3.1": | |
| 92, | |
| "free-canvas@1.0.1": | |
| 78, | |
| "free-canvas@2.0.0": | |
| 343, | |
| "free-canvas@2.1.0": | |
| 230, | |
| "free-canvas@3.0.0": | |
| 111, | |
| "free-group@1.0.0": | |
| 95, | |
| "free-group@1.1.0": | |
| 95, | |
| "free-group@1.1.1": | |
| 96, | |
| "free-group@1.1.2": | |
| 100, | |
| "free-group@1.1.3": | |
| 96, | |
| "free-monadplus@0.1.0": | |
| 391, | |
| "freeap@0.1.3": | |
| 52, | |
| "freeap@1.0.0": | |
| 51, | |
| "freeap@2.0.0": | |
| -82, | |
| "freeap@3.0.0": | |
| 101, | |
| "freeap@3.0.1": | |
| 180, | |
| "freeap@4.0.0": | |
| 124, | |
| "freeap@5.0.0": | |
| 94, | |
| "freeap@5.0.1": | |
| 191, | |
| "freeap@6.0.0": | |
| 87, | |
| "freeap@7.0.0": | |
| 64, | |
| "freearr@0.1.0": | |
| 79, | |
| "freedom@0.0.1": | |
| 331, | |
| "freedom@0.0.2": | |
| 319, | |
| "freedom@0.0.3": | |
| 322, | |
| "freedom@0.0.4": | |
| 407, | |
| "freedom@0.1.0": | |
| 307, | |
| "freedom@0.1.1": | |
| 301, | |
| "freedom@0.2.0": | |
| 317, | |
| "freedom@0.3.0": | |
| 317, | |
| "freedom@0.4.0": | |
| 318, | |
| "freedom@0.5.0": | |
| 318, | |
| "freedom@0.6.0": | |
| 318, | |
| "freedom@0.6.1": | |
| 400, | |
| "freedom@0.6.2": | |
| 299, | |
| "freedom@0.6.3": | |
| 313, | |
| "freedom@1.0.0": | |
| 364, | |
| "freedom@1.1.0": | |
| 333, | |
| "freedom@1.1.1": | |
| 435, | |
| "freedom@1.1.2": | |
| 336, | |
| "freedom@1.2.0": | |
| 331, | |
| "freedom@1.3.0": | |
| 347, | |
| "freedom@1.4.0": | |
| 336, | |
| "freedom@1.4.1": | |
| 336, | |
| "freedom@2.0.0": | |
| 488, | |
| "freedom@2.1.0": | |
| 374, | |
| "freedom@2.2.0": | |
| 369, | |
| "freedom-now@1.0.0": | |
| 635, | |
| "freedom-now@2.0.0": | |
| 635, | |
| "freedom-now@3.0.0": | |
| 572, | |
| "freedom-portal@0.0.1": | |
| 501, | |
| "freedom-portal@0.0.2": | |
| 595, | |
| "freedom-portal@0.1.0": | |
| 487, | |
| "freedom-portal@0.2.0": | |
| 479, | |
| "freedom-portal@0.3.0": | |
| 493, | |
| "freedom-portal@0.4.0": | |
| 495, | |
| "freedom-portal@0.5.0": | |
| 500, | |
| "freedom-portal@1.0.0": | |
| 647, | |
| "freedom-portal@2.0.0": | |
| 679, | |
| "freedom-router@0.0.1": | |
| 339, | |
| "freedom-router@0.0.2": | |
| 341, | |
| "freedom-router@0.0.3": | |
| 357, | |
| "freedom-router@0.1.0": | |
| 360, | |
| "freedom-router@0.2.0": | |
| 355, | |
| "freedom-router@0.3.0": | |
| 357, | |
| "freedom-router@0.4.0": | |
| 428, | |
| "freedom-router@0.5.0": | |
| 358, | |
| "freedom-router@1.0.0": | |
| 469, | |
| "freedom-router@1.0.1": | |
| 480, | |
| "freedom-router@2.0.0": | |
| 461, | |
| "freedom-transition@0.1.0": | |
| 594, | |
| "freedom-transition@1.0.0": | |
| 627, | |
| "freedom-transition@1.0.1": | |
| 529, | |
| "freedom-transition@2.0.0": | |
| 573, | |
| "freedom-virtualized@0.1.0": | |
| 497, | |
| "freedom-virtualized@0.1.1": | |
| 601, | |
| "freedom-virtualized@0.1.2": | |
| 485, | |
| "freedom-virtualized@0.2.0": | |
| 482, | |
| "freedom-virtualized@1.0.0": | |
| 641, | |
| "freedom-virtualized@1.1.0": | |
| 646, | |
| "freedom-virtualized@2.0.0": | |
| 650, | |
| "freedom-virtualized@3.0.0": | |
| 580, | |
| "freedom-virtualized@3.0.1": | |
| 707, | |
| "freedom-window-resize@0.1.0": | |
| 480, | |
| "freedom-window-resize@0.2.0": | |
| 483, | |
| "freedom-window-resize@1.0.0": | |
| 642, | |
| "freedom-window-resize@2.0.0": | |
| 576, | |
| "freer-free@0.0.1": | |
| 58, | |
| "freet@0.1.0": | |
| 87, | |
| "freet@0.1.1": | |
| 142, | |
| "freet@0.1.2": | |
| 92, | |
| "freet@0.1.3": | |
| 52, | |
| "freet@0.2.0": | |
| 78, | |
| "freet@0.3.0": | |
| 75, | |
| "freet@0.3.1": | |
| 84, | |
| "freet@1.0.0": | |
| 77, | |
| "freet@1.0.1": | |
| 79, | |
| "freet@2.0.0": | |
| 204, | |
| "freet@2.0.1": | |
| 90, | |
| "freet@2.1.0": | |
| 103, | |
| "freet@3.0.0": | |
| 124, | |
| "freet@4.0.0": | |
| 92, | |
| "freet@4.0.1": | |
| 97, | |
| "freet@4.1.0": | |
| 96, | |
| "freet@5.0.0": | |
| 180, | |
| "freet@6.0.0": | |
| 199, | |
| "freet@7.0.0": | |
| 84, | |
| "function-eff@0.1.0": | |
| 41, | |
| "function-run@0.1.0": | |
| 62, | |
| "functional-maps@1.0.0": | |
| 92, | |
| "functions@0.1.0": | |
| 62, | |
| "functions@1.0.0": | |
| 68, | |
| "functions@2.0.0": | |
| 69, | |
| "functions@3.0.0": | |
| 76, | |
| "functions@4.0.0": | |
| 141, | |
| "functions@5.0.0": | |
| 51, | |
| "functions@6.0.0": | |
| 62, | |
| "functor-compose@0.1.0": | |
| 68, | |
| "functor-coproducts@1.0.0": | |
| 69, | |
| "functor-coproducts@1.0.1": | |
| 67, | |
| "functor-coproducts@1.1.0": | |
| 69, | |
| "functor-coproducts@2.0.0": | |
| 90, | |
| "functor-products@1.0.0": | |
| 149, | |
| "functor-products@2.0.0": | |
| 85, | |
| "functor-vector@0.1.0": | |
| 228, | |
| "functor1@1.0.0": | |
| 55, | |
| "functor1@2.0.0": | |
| 72, | |
| "functor1@3.0.0": | |
| 62, | |
| "functors@0.1.0": | |
| 88, | |
| "functors@0.1.1": | |
| 69, | |
| "functors@0.1.2": | |
| 160, | |
| "functors@1.0.0": | |
| 151, | |
| "functors@1.1.0": | |
| 76, | |
| "functors@2.0.0": | |
| 98, | |
| "functors@2.1.0": | |
| 109, | |
| "functors@2.2.0": | |
| 105, | |
| "functors@3.0.0": | |
| 81, | |
| "functors@3.0.1": | |
| 155, | |
| "functors@3.1.0": | |
| 87, | |
| "functors@3.1.1": | |
| 56, | |
| "functors@4.0.0": | |
| 72, | |
| "functors@4.1.0": | |
| 69, | |
| "functors@4.1.1": | |
| 72, | |
| "functors@5.0.0": | |
| 75, | |
| "fuzzy@0.1.1": | |
| 193, | |
| "fuzzy@0.1.2": | |
| 277, | |
| "fuzzy@0.2.0": | |
| 197, | |
| "fuzzy@0.2.1": | |
| 277, | |
| "fuzzy@0.3.0": | |
| 147, | |
| "fuzzy@0.4.0": | |
| -109, | |
| "game@1.0.0": | |
| 310, | |
| "game@2.0.0": | |
| 251, | |
| "game@2.0.1": | |
| 247, | |
| "gametree@1.0.0": | |
| 154, | |
| "gametree@2.0.0": | |
| 163, | |
| "gametree@3.0.0": | |
| 230, | |
| "gdp@0.1.0": | |
| 54, | |
| "gejang@1.0.0": | |
| 128, | |
| "gen@1.0.0": | |
| 94, | |
| "gen@1.1.0": | |
| 100, | |
| "gen@1.1.1": | |
| 177, | |
| "gen@1.2.0": | |
| 81, | |
| "gen@1.2.1": | |
| 90, | |
| "gen@1.3.0": | |
| 100, | |
| "gen@1.3.1": | |
| 99, | |
| "gen@2.0.0": | |
| 85, | |
| "gen@2.1.0": | |
| 153, | |
| "gen@2.1.1": | |
| 98, | |
| "gen@3.0.0": | |
| 60, | |
| "gen@4.0.0": | |
| 79, | |
| "generate-values@1.0.1": | |
| 1142, | |
| "generic-graphviz@1.0.1": | |
| 266, | |
| "generic-graphviz@1.0.2": | |
| 271, | |
| "generic-graphviz@1.1.1": | |
| 260, | |
| "generic-graphviz@2.0.0": | |
| 502, | |
| "generic-graphviz@2.0.1": | |
| 359, | |
| "generic-router@0.0.1": | |
| 74, | |
| "generics@0.1.0": | |
| 69, | |
| "generics@0.2.0": | |
| 74, | |
| "generics@0.3.0": | |
| 76, | |
| "generics@0.3.1": | |
| 71, | |
| "generics@0.4.0": | |
| 144, | |
| "generics@0.5.0": | |
| 73, | |
| "generics@0.5.1": | |
| 51, | |
| "generics@0.6.0": | |
| 72, | |
| "generics@0.6.1": | |
| 72, | |
| "generics@0.6.2": | |
| 71, | |
| "generics@0.7.0": | |
| 75, | |
| "generics@0.7.1": | |
| 77, | |
| "generics@0.7.2": | |
| 121, | |
| "generics@1.0.0": | |
| 88, | |
| "generics@1.0.1": | |
| 45, | |
| "generics@2.0.0": | |
| 87, | |
| "generics@3.0.0": | |
| 90, | |
| "generics@3.1.0": | |
| 97, | |
| "generics@3.2.0": | |
| 86, | |
| "generics@3.3.0": | |
| 90, | |
| "generics@4.0.0": | |
| 277, | |
| "generics@4.0.1": | |
| 201, | |
| "generics-rep@1.0.0": | |
| 41, | |
| "generics-rep@2.0.0": | |
| 62, | |
| "generics-rep@3.0.0": | |
| 73, | |
| "generics-rep@4.0.0": | |
| 61, | |
| "generics-rep@4.1.0": | |
| 79, | |
| "generics-rep@5.0.0": | |
| 66, | |
| "generics-rep@5.1.0": | |
| 146, | |
| "generics-rep@5.2.0": | |
| 181, | |
| "generics-rep@5.3.0": | |
| 160, | |
| "generics-rep@5.4.0": | |
| 171, | |
| "generics-rep@6.0.0": | |
| 89, | |
| "generics-rep@6.1.0": | |
| 93, | |
| "generics-rep@6.1.1": | |
| 90, | |
| "generics-rep@6.1.2": | |
| 92, | |
| "generics-rep@6.1.3": | |
| 183, | |
| "generics-rep@6.1.4": | |
| 80, | |
| "generics-rep-optics@0.1.0": | |
| 395, | |
| "generics-rep-optics@1.0.0": | |
| 199, | |
| "generics-rep-optics@1.0.1": | |
| 200, | |
| "generics-rep-optics@1.0.2": | |
| 200, | |
| "generics-rep-optics@1.1.0": | |
| 201, | |
| "geom@1.0.0": | |
| 54, | |
| "geom@1.1.0": | |
| 133, | |
| "geom@2.0.0": | |
| 88, | |
| "geom@3.0.0": | |
| 73, | |
| "geometry@0.0.0": | |
| 71, | |
| "geometry@0.0.1": | |
| 77, | |
| "geometry@0.0.2": | |
| 72, | |
| "geometry-plane@1.0.2": | |
| 231, | |
| "geometry-plane@1.0.3": | |
| 104, | |
| "github-actions-toolkit@0.1.0": | |
| 346, | |
| "github-actions-toolkit@0.2.0": | |
| 231, | |
| "github-actions-toolkit@0.2.1": | |
| 235, | |
| "github-actions-toolkit@0.2.2": | |
| 243, | |
| "github-actions-toolkit@0.3.0": | |
| 129, | |
| "github-actions-toolkit@0.4.0": | |
| 111, | |
| "github-actions-toolkit@0.5.0": | |
| 188, | |
| "github-corners@0.1.0": | |
| 362, | |
| "github-corners@0.1.1": | |
| 351, | |
| "github-corners@0.2.0": | |
| 362, | |
| "github-corners@0.2.1": | |
| 367, | |
| "gl-matrix@1.0.0": | |
| 143, | |
| "gl-matrix@1.0.1": | |
| 238, | |
| "gl-matrix@2.0.0": | |
| 129, | |
| "gl-matrix@2.0.1": | |
| 69, | |
| "gl-matrix@2.1.0": | |
| 83, | |
| "glapple@1.0.0": | |
| -328, | |
| "glapple@1.0.1": | |
| -341, | |
| "glapple@1.0.2": | |
| -336, | |
| "glapple@1.1.0": | |
| -443, | |
| "glapple@1.1.1": | |
| -333, | |
| "glapple@2.0.0": | |
| -316, | |
| "glapple@2.0.1": | |
| -322, | |
| "glapple@2.0.2": | |
| -325, | |
| "glapple@2.1.0": | |
| -325, | |
| "glapple@3.0.0": | |
| -433, | |
| "glitter@0.0.1": | |
| 858, | |
| "glitter@0.1.0": | |
| 839, | |
| "globals@0.1.0": | |
| 65, | |
| "globals@0.1.1": | |
| 67, | |
| "globals@0.1.2": | |
| 62, | |
| "globals@0.1.3": | |
| 66, | |
| "globals@0.1.4": | |
| 134, | |
| "globals@0.1.5": | |
| 49, | |
| "globals@0.1.6": | |
| 52, | |
| "globals@0.2.0": | |
| 68, | |
| "globals@0.2.1": | |
| 67, | |
| "globals@0.2.2": | |
| 67, | |
| "globals@1.0.0": | |
| 66, | |
| "globals@1.1.0": | |
| 130, | |
| "globals@2.0.0": | |
| 54, | |
| "globals@3.0.0": | |
| 51, | |
| "globals@4.0.0": | |
| 65, | |
| "globals@4.1.0": | |
| 69, | |
| "globals@5.0.0": | |
| 62, | |
| "gm@1.0.0": | |
| 143, | |
| "gomtang-basic@0.1.0": | |
| 563, | |
| "gomtang-basic@0.2.0": | |
| 385, | |
| "google-apps@0.0.1": | |
| 94, | |
| "google-apps@0.0.2": | |
| 112, | |
| "google-apps@0.0.3": | |
| 112, | |
| "google-cloud-datastore@0.1.0": | |
| 497, | |
| "grain@0.1.0": | |
| 335, | |
| "grain@0.2.0": | |
| 338, | |
| "grain@0.3.0": | |
| 443, | |
| "grain@0.4.0": | |
| 463, | |
| "grain@0.4.1": | |
| 464, | |
| "grain@0.5.0": | |
| 477, | |
| "grain@0.7.0": | |
| 472, | |
| "grain@0.8.0": | |
| 565, | |
| "grain@0.9.0": | |
| 465, | |
| "grain@1.0.0": | |
| 452, | |
| "grain@2.0.0": | |
| 212, | |
| "grain@3.0.0": | |
| 115, | |
| "grain-portal@0.1.0": | |
| 491, | |
| "grain-portal@0.1.1": | |
| 490, | |
| "grain-router@0.1.0": | |
| 392, | |
| "grain-router@0.2.0": | |
| 508, | |
| "grain-router@0.3.0": | |
| 368, | |
| "grain-router@0.4.0": | |
| 517, | |
| "grain-router@0.4.1": | |
| 516, | |
| "grain-router@0.5.0": | |
| 525, | |
| "grain-router@0.7.0": | |
| 520, | |
| "grain-router@0.8.0": | |
| 622, | |
| "grain-router@0.9.0": | |
| 501, | |
| "grain-router@1.0.0": | |
| 509, | |
| "grain-router@2.0.0": | |
| 212, | |
| "grain-router@3.0.0": | |
| 110, | |
| "grain-virtualized@0.1.0": | |
| 649, | |
| "grain-virtualized@0.1.1": | |
| 475, | |
| "grain-virtualized@0.2.0": | |
| 471, | |
| "grain-virtualized@0.3.0": | |
| 488, | |
| "grain-virtualized@0.4.0": | |
| 1543, | |
| "grain-virtualized@0.4.1": | |
| 1548, | |
| "grain-virtualized@0.5.0": | |
| 1567, | |
| "grain-virtualized@0.7.0": | |
| 1668, | |
| "grain-virtualized@0.8.0": | |
| 1528, | |
| "grain-virtualized@0.9.0": | |
| 1529, | |
| "grain-virtualized@1.0.0": | |
| 1542, | |
| "grain-virtualized@2.0.0": | |
| 486, | |
| "grain-virtualized@3.0.0": | |
| 109, | |
| "graphics-vis@1.0.0": | |
| 171, | |
| "graphics-vis@2.0.0": | |
| 293, | |
| "graphql@1.0.0": | |
| 284, | |
| "graphql@1.0.1": | |
| 284, | |
| "graphql@1.0.2": | |
| 322, | |
| "graphql-client@0.1.0": | |
| 450, | |
| "graphql-client@0.1.1": | |
| 447, | |
| "graphql-client@0.2.0": | |
| 543, | |
| "graphql-client@1.4.5": | |
| 570, | |
| "graphql-client@1.5.0": | |
| 575, | |
| "graphql-client@1.5.1": | |
| 581, | |
| "graphql-client@1.6.1": | |
| 715, | |
| "graphql-client@1.6.4": | |
| 569, | |
| "graphql-client@1.6.5": | |
| 572, | |
| "graphql-client@1.6.6": | |
| 581, | |
| "graphql-client@1.6.7": | |
| 584, | |
| "graphql-client@1.6.9": | |
| 586, | |
| "graphql-client@1.6.11": | |
| 725, | |
| "graphql-client@1.6.13": | |
| 566, | |
| "graphql-client@1.7.0": | |
| 575, | |
| "graphql-client@1.7.1": | |
| 586, | |
| "graphql-client@1.7.3": | |
| 588, | |
| "graphql-client@1.7.5": | |
| 587, | |
| "graphql-client@1.7.6": | |
| 697, | |
| "graphql-client@1.7.7": | |
| 570, | |
| "graphql-client@1.7.8": | |
| 565, | |
| "graphql-client@1.7.9": | |
| 580, | |
| "graphql-client@1.7.10": | |
| 453, | |
| "graphql-client@1.7.11": | |
| 456, | |
| "graphql-client@1.7.13": | |
| 457, | |
| "graphql-client@1.7.14": | |
| 549, | |
| "graphql-client@1.7.17": | |
| 444, | |
| "graphql-client@1.7.19": | |
| 448, | |
| "graphql-client@1.7.21": | |
| 464, | |
| "graphql-client@1.7.23": | |
| 461, | |
| "graphql-client@1.7.24": | |
| 455, | |
| "graphql-client@1.7.27": | |
| 558, | |
| "graphql-client@2.0.0": | |
| 453, | |
| "graphql-client@2.0.1": | |
| 457, | |
| "graphql-client@2.0.2": | |
| 469, | |
| "graphql-client@2.0.3": | |
| 473, | |
| "graphql-client@2.0.4": | |
| 574, | |
| "graphql-client@2.0.5": | |
| 465, | |
| "graphql-client@2.0.6": | |
| 449, | |
| "graphql-client@2.0.7": | |
| 470, | |
| "graphql-client@2.0.8": | |
| 471, | |
| "graphql-client@2.0.9": | |
| 477, | |
| "graphql-client@2.0.10": | |
| 473, | |
| "graphql-client@2.0.11": | |
| 622, | |
| "graphql-client@2.0.12": | |
| 461, | |
| "graphql-client@2.0.14": | |
| 460, | |
| "graphql-client@2.1.6": | |
| 476, | |
| "graphql-client@2.1.8": | |
| 473, | |
| "graphql-client@2.2.0": | |
| 473, | |
| "graphql-client@2.2.1": | |
| 582, | |
| "graphql-client@2.2.2": | |
| 460, | |
| "graphql-client@2.3.0": | |
| 455, | |
| "graphql-client@3.0.0": | |
| 470, | |
| "graphql-client@3.0.1": | |
| 469, | |
| "graphql-client@3.0.2": | |
| 473, | |
| "graphql-client@3.0.4": | |
| 473, | |
| "graphql-client@3.0.5": | |
| 604, | |
| "graphql-client@4.0.1": | |
| 245, | |
| "graphql-client@4.0.4": | |
| 240, | |
| "graphql-client@4.0.9": | |
| 258, | |
| "graphql-client@4.0.12": | |
| 257, | |
| "graphql-client@4.0.13": | |
| 261, | |
| "graphql-client@4.0.14": | |
| 259, | |
| "graphql-client@4.0.15": | |
| 333, | |
| "graphql-client@4.0.16": | |
| 243, | |
| "graphql-client@4.0.17": | |
| 247, | |
| "graphql-client@4.0.18": | |
| 258, | |
| "graphql-client@6.0.0": | |
| 258, | |
| "graphql-client@7.0.0": | |
| 354, | |
| "graphql-client@7.0.4": | |
| 229, | |
| "graphql-client@7.0.5": | |
| 219, | |
| "graphql-client@7.0.6": | |
| 237, | |
| "graphql-client@7.0.7": | |
| 235, | |
| "graphql-client@8.0.2": | |
| 238, | |
| "graphql-client@8.0.3": | |
| 350, | |
| "graphql-client@8.1.0": | |
| 224, | |
| "graphql-client@9.1.1": | |
| 187, | |
| "graphql-client@9.2.2": | |
| 195, | |
| "graphql-parser@0.0.0": | |
| 196, | |
| "graphql-parser@0.0.1": | |
| 193, | |
| "graphql-parser@0.0.2": | |
| 190, | |
| "graphql-parser@0.0.3": | |
| 284, | |
| "graphql-parser@0.0.4": | |
| 180, | |
| "graphql-parser@0.0.5": | |
| 181, | |
| "graphql-parser@0.0.6": | |
| 191, | |
| "graphql-parser@0.0.7": | |
| 205, | |
| "graphql-parser@0.0.8": | |
| 193, | |
| "graphql-parser@0.0.9": | |
| 323, | |
| "graphql-parser@0.0.10": | |
| 181, | |
| "graphql-parser@0.0.11": | |
| 177, | |
| "graphqlclient@1.2.0": | |
| 181, | |
| "graphqlclient@1.2.1": | |
| 182, | |
| "graphs@0.1.0": | |
| -70, | |
| "graphs@0.2.0": | |
| 69, | |
| "graphs@0.3.0": | |
| 191, | |
| "graphs@0.3.1": | |
| 80, | |
| "graphs@0.4.0": | |
| 69, | |
| "graphs@0.5.0": | |
| 136, | |
| "graphs@1.0.0": | |
| 78, | |
| "graphs@2.0.0": | |
| 233, | |
| "graphs@3.0.0": | |
| 272, | |
| "graphs@4.0.0": | |
| 124, | |
| "graphs@5.0.0": | |
| 173, | |
| "graphs@8.0.0": | |
| 73, | |
| "graphs@8.1.0": | |
| 72, | |
| "graphviz@1.0.0": | |
| 351, | |
| "graphviz@1.1.0": | |
| 188, | |
| "graphviz@1.1.1": | |
| 192, | |
| "graphviz@1.2.0": | |
| 281, | |
| "graphviz@1.3.0": | |
| 180, | |
| "grid-reactors@0.0.1": | |
| 160, | |
| "grid-reactors@2.1.0": | |
| 171, | |
| "grid-reactors@3.0.0": | |
| 163, | |
| "grid-reactors@3.0.1": | |
| 254, | |
| "grid-reactors@4.0.0": | |
| 157, | |
| "group@1.0.0": | |
| 43, | |
| "group@1.1.0": | |
| 71, | |
| "group@2.0.0": | |
| 73, | |
| "group@2.1.0": | |
| 71, | |
| "group@3.0.0": | |
| 84, | |
| "group@3.1.0": | |
| 111, | |
| "group@3.2.0": | |
| 87, | |
| "group@3.2.1": | |
| 82, | |
| "group@3.2.2": | |
| 95, | |
| "group@3.3.0": | |
| 92, | |
| "group@4.0.0": | |
| 88, | |
| "group@4.1.0": | |
| 85, | |
| "group@4.1.1": | |
| 88, | |
| "gun@0.1.0": | |
| 313, | |
| "gun@0.1.1": | |
| 194, | |
| "halogen@0.1.0": | |
| 59, | |
| "halogen@0.2.0": | |
| 88, | |
| "halogen@0.3.0": | |
| 80, | |
| "halogen@0.4.0": | |
| 92, | |
| "halogen@0.4.1": | |
| 90, | |
| "halogen@0.5.0": | |
| 258, | |
| "halogen@0.5.1": | |
| 132, | |
| "halogen@0.5.2": | |
| 123, | |
| "halogen@0.5.3": | |
| 132, | |
| "halogen@0.5.4": | |
| 136, | |
| "halogen@0.5.5": | |
| 135, | |
| "halogen@0.5.6": | |
| 147, | |
| "halogen@0.5.7": | |
| 139, | |
| "halogen@0.5.8": | |
| 236, | |
| "halogen@0.5.9": | |
| 131, | |
| "halogen@0.5.10": | |
| 129, | |
| "halogen@0.5.11": | |
| 140, | |
| "halogen@0.5.12": | |
| 140, | |
| "halogen@0.5.13": | |
| 140, | |
| "halogen@0.5.14": | |
| 257, | |
| "halogen@0.5.15": | |
| 135, | |
| "halogen@0.5.16": | |
| 126, | |
| "halogen@0.5.17": | |
| 142, | |
| "halogen@0.5.18": | |
| 138, | |
| "halogen@0.6.0": | |
| 133, | |
| "halogen@0.6.1": | |
| 133, | |
| "halogen@0.6.2": | |
| 226, | |
| "halogen@0.7.0": | |
| 130, | |
| "halogen@0.7.1": | |
| 123, | |
| "halogen@0.8.0": | |
| 127, | |
| "halogen@0.9.0": | |
| 91, | |
| "halogen@0.10.0": | |
| 91, | |
| "halogen@0.11.0": | |
| -205, | |
| "halogen@0.12.0": | |
| -465, | |
| "halogen@1.0.0": | |
| -527, | |
| "halogen@1.1.0": | |
| -395, | |
| "halogen@1.2.0": | |
| -381, | |
| "halogen@1.2.1": | |
| -395, | |
| "halogen@2.0.0": | |
| 723, | |
| "halogen@2.0.1": | |
| 791, | |
| "halogen@2.1.0": | |
| 755, | |
| "halogen@2.2.0": | |
| 674, | |
| "halogen@2.3.0": | |
| 678, | |
| "halogen@3.0.0": | |
| 600, | |
| "halogen@3.0.1": | |
| 611, | |
| "halogen@3.1.0": | |
| 603, | |
| "halogen@3.1.1": | |
| 740, | |
| "halogen@3.1.2": | |
| 633, | |
| "halogen@3.1.3": | |
| 598, | |
| "halogen@4.0.0": | |
| 319, | |
| "halogen@5.0.0": | |
| 282, | |
| "halogen@5.0.1": | |
| 280, | |
| "halogen@5.0.2": | |
| 382, | |
| "halogen@5.1.0": | |
| 276, | |
| "halogen@5.1.1": | |
| 261, | |
| "halogen@6.0.0": | |
| 151, | |
| "halogen@6.1.0": | |
| 160, | |
| "halogen@6.1.1": | |
| 164, | |
| "halogen@6.1.2": | |
| 171, | |
| "halogen@6.1.3": | |
| 163, | |
| "halogen@7.0.0": | |
| 298, | |
| "halogen-bootstrap@0.1.0": | |
| 98, | |
| "halogen-bootstrap@0.4.0": | |
| 229, | |
| "halogen-bootstrap@0.5.0": | |
| 165, | |
| "halogen-bootstrap@0.6.0": | |
| 164, | |
| "halogen-bootstrap@0.7.0": | |
| 160, | |
| "halogen-bootstrap@1.0.0": | |
| 103, | |
| "halogen-bootstrap@2.0.0": | |
| 184, | |
| "halogen-bootstrap@3.0.0": | |
| -293, | |
| "halogen-bootstrap@4.0.0": | |
| -693, | |
| "halogen-bootstrap@5.0.0": | |
| -598, | |
| "halogen-bootstrap@6.0.0": | |
| 1386, | |
| "halogen-bootstrap@7.0.0": | |
| 1175, | |
| "halogen-bootstrap@8.0.0": | |
| 545, | |
| "halogen-bootstrap4@0.1.0": | |
| 552, | |
| "halogen-bootstrap4@0.1.2": | |
| 575, | |
| "halogen-bootstrap4@0.1.3": | |
| 571, | |
| "halogen-bootstrap4@0.1.4": | |
| 580, | |
| "halogen-bootstrap4@0.2.0": | |
| 236, | |
| "halogen-bootstrap5@1.0.0": | |
| 337, | |
| "halogen-bootstrap5@2.0.0": | |
| 222, | |
| "halogen-bootstrap5@2.1.0": | |
| 230, | |
| "halogen-bulma@1.0.0": | |
| 573, | |
| "halogen-bulma@1.0.1": | |
| 570, | |
| "halogen-bulma@1.0.2": | |
| 658, | |
| "halogen-bulma@1.0.3": | |
| 550, | |
| "halogen-calendar-datepicker@0.0.1": | |
| 1168, | |
| "halogen-calendar-datepicker@0.0.2": | |
| 1173, | |
| "halogen-calendar-datepicker@0.0.3": | |
| 1180, | |
| "halogen-calendar-datepicker@0.0.4": | |
| 1188, | |
| "halogen-calendar-datepicker@0.0.5": | |
| 1333, | |
| "halogen-css@0.1.0": | |
| -175, | |
| "halogen-css@0.1.1": | |
| -166, | |
| "halogen-css@0.2.0": | |
| -186, | |
| "halogen-css@0.2.1": | |
| -187, | |
| "halogen-css@0.2.2": | |
| -186, | |
| "halogen-css@0.3.0": | |
| -143, | |
| "halogen-css@0.4.0": | |
| -228, | |
| "halogen-css@0.5.0": | |
| -135, | |
| "halogen-css@1.0.0": | |
| 90, | |
| "halogen-css@2.0.0": | |
| 101, | |
| "halogen-css@3.0.0": | |
| -259, | |
| "halogen-css@4.0.0": | |
| -697, | |
| "halogen-css@5.0.0": | |
| -565, | |
| "halogen-css@6.0.0": | |
| 1483, | |
| "halogen-css@7.0.0": | |
| 992, | |
| "halogen-css@8.0.0": | |
| 575, | |
| "halogen-css@9.0.0": | |
| 360, | |
| "halogen-css@10.0.0": | |
| 260, | |
| "halogen-datepicker@0.1.0": | |
| 1424, | |
| "halogen-datepicker@1.0.0": | |
| 960, | |
| "halogen-datepicker@2.0.0": | |
| 302, | |
| "halogen-day-picker@0.1.0": | |
| 891, | |
| "halogen-day-picker@0.1.1": | |
| 892, | |
| "halogen-day-picker@0.1.2": | |
| 901, | |
| "halogen-day-picker@0.2.0": | |
| 374, | |
| "halogen-day-picker@0.3.0": | |
| 479, | |
| "halogen-day-picker@0.4.0": | |
| 356, | |
| "halogen-dialog@0.0.1": | |
| 98, | |
| "halogen-dialog@0.0.2": | |
| 121, | |
| "halogen-dialog@0.1.0": | |
| 103, | |
| "halogen-driver@1.0.0": | |
| 569, | |
| "halogen-driver@2.0.0": | |
| 699, | |
| "halogen-echarts@0.1.0": | |
| -190, | |
| "halogen-echarts@0.1.1": | |
| -183, | |
| "halogen-echarts@0.2.0": | |
| -198, | |
| "halogen-echarts@0.3.0": | |
| -200, | |
| "halogen-echarts@0.4.0": | |
| -200, | |
| "halogen-echarts@0.5.0": | |
| -168, | |
| "halogen-echarts@0.6.0": | |
| -276, | |
| "halogen-echarts@0.7.0": | |
| -159, | |
| "halogen-echarts@0.8.0": | |
| -156, | |
| "halogen-echarts@1.0.0": | |
| 121, | |
| "halogen-echarts@2.0.0": | |
| -398, | |
| "halogen-echarts@3.0.0": | |
| -890, | |
| "halogen-echarts@4.0.0": | |
| -946, | |
| "halogen-echarts@4.1.0": | |
| -816, | |
| "halogen-echarts@5.0.0": | |
| -825, | |
| "halogen-echarts@6.0.0": | |
| 1730, | |
| "halogen-echarts@7.0.0": | |
| 1774, | |
| "halogen-echarts@8.0.0": | |
| 1737, | |
| "halogen-echarts@9.0.0": | |
| 1453, | |
| "halogen-echarts@10.0.0": | |
| 1287, | |
| "halogen-echarts@11.0.0": | |
| -1237, | |
| "halogen-echarts@12.0.0": | |
| 1272, | |
| "halogen-echarts@13.0.0": | |
| 1111, | |
| "halogen-echarts@14.0.0": | |
| 930, | |
| "halogen-formless@0.1.0": | |
| 488, | |
| "halogen-formless@0.1.1": | |
| 508, | |
| "halogen-formless@0.2.0": | |
| 443, | |
| "halogen-formless@0.3.0": | |
| 469, | |
| "halogen-formless@0.3.1": | |
| 574, | |
| "halogen-formless@0.4.0": | |
| 417, | |
| "halogen-formless@0.4.1": | |
| 413, | |
| "halogen-formless@0.5.0": | |
| 434, | |
| "halogen-formless@0.5.1": | |
| 427, | |
| "halogen-formless@0.5.2": | |
| 430, | |
| "halogen-formless@1.0.0": | |
| 510, | |
| "halogen-formless@2.0.0": | |
| 178, | |
| "halogen-formless@2.0.1": | |
| 173, | |
| "halogen-formless@2.1.0": | |
| 195, | |
| "halogen-formless@2.2.0": | |
| 192, | |
| "halogen-formless@3.0.0": | |
| 165, | |
| "halogen-formless@4.0.0": | |
| -202, | |
| "halogen-formless@4.0.2": | |
| -321, | |
| "halogen-foundation@0.1.0": | |
| 100, | |
| "halogen-framework7@0.1.0": | |
| -222, | |
| "halogen-framework7@0.1.1": | |
| -229, | |
| "halogen-framework7@0.1.2": | |
| -234, | |
| "halogen-framework7@0.1.3": | |
| -260, | |
| "halogen-framework7@0.1.4": | |
| -238, | |
| "halogen-framework7@0.1.5": | |
| -235, | |
| "halogen-framework7@0.1.6": | |
| -330, | |
| "halogen-framework7@0.1.7": | |
| -205, | |
| "halogen-framework7@0.1.8": | |
| -213, | |
| "halogen-framework7@0.1.9": | |
| -218, | |
| "halogen-framework7@0.1.10": | |
| -222, | |
| "halogen-framework7@0.1.11": | |
| -220, | |
| "halogen-framework7@0.1.12": | |
| -316, | |
| "halogen-framework7@0.2.0": | |
| -608, | |
| "halogen-framework7@0.2.1": | |
| -597, | |
| "halogen-framework7@0.2.2": | |
| -609, | |
| "halogen-framework7@0.2.3": | |
| -614, | |
| "halogen-framework7@0.2.4": | |
| -613, | |
| "halogen-framework7@0.2.5": | |
| -715, | |
| "halogen-framework7@0.2.6": | |
| -599, | |
| "halogen-framework7@0.2.7": | |
| -609, | |
| "halogen-framework7@0.2.8": | |
| -619, | |
| "halogen-framework7@0.2.9": | |
| -615, | |
| "halogen-hooks@0.1.0": | |
| 582, | |
| "halogen-hooks@0.2.0": | |
| 451, | |
| "halogen-hooks@0.2.1": | |
| 455, | |
| "halogen-hooks@0.3.0": | |
| 462, | |
| "halogen-hooks@0.4.0": | |
| 465, | |
| "halogen-hooks@0.4.1": | |
| 475, | |
| "halogen-hooks@0.4.2": | |
| 575, | |
| "halogen-hooks@0.4.3": | |
| 448, | |
| "halogen-hooks@0.5.0": | |
| 220, | |
| "halogen-hooks@0.5.1": | |
| 234, | |
| "halogen-hooks@0.6.0": | |
| 271, | |
| "halogen-hooks@0.6.1": | |
| 269, | |
| "halogen-hooks@0.6.2": | |
| -238, | |
| "halogen-hooks@0.6.3": | |
| 210, | |
| "halogen-hooks-extra@0.1.0": | |
| 598, | |
| "halogen-hooks-extra@0.1.1": | |
| 479, | |
| "halogen-hooks-extra@0.2.0": | |
| 487, | |
| "halogen-hooks-extra@0.2.1": | |
| 495, | |
| "halogen-hooks-extra@0.2.2": | |
| 500, | |
| "halogen-hooks-extra@0.3.0": | |
| 668, | |
| "halogen-hooks-extra@0.4.0": | |
| 533, | |
| "halogen-hooks-extra@0.5.0": | |
| 490, | |
| "halogen-hooks-extra@0.5.1": | |
| 500, | |
| "halogen-hooks-extra@0.6.0": | |
| 553, | |
| "halogen-hooks-extra@0.6.1": | |
| 363, | |
| "halogen-hooks-extra@0.6.2": | |
| 444, | |
| "halogen-hooks-extra@0.6.3": | |
| 345, | |
| "halogen-hooks-extra@0.7.0": | |
| 347, | |
| "halogen-hooks-extra@0.7.1": | |
| 556, | |
| "halogen-hooks-extra@0.8.0": | |
| 267, | |
| "halogen-hooks-extra@0.9.0": | |
| 393, | |
| "halogen-leaflet@0.0.1": | |
| 1340, | |
| "halogen-leaflet@0.1.0": | |
| 1253, | |
| "halogen-menu@0.5.0": | |
| 164, | |
| "halogen-menu@0.6.0": | |
| 165, | |
| "halogen-menu@0.7.0": | |
| 160, | |
| "halogen-menu@1.0.0": | |
| 98, | |
| "halogen-menu@2.0.0": | |
| -377, | |
| "halogen-menu@3.0.0": | |
| -490, | |
| "halogen-menu@4.0.0": | |
| -591, | |
| "halogen-menu@5.0.0": | |
| 1766, | |
| "halogen-proxy@1.0.0": | |
| 1009, | |
| "halogen-pure@0.0.1": | |
| 56, | |
| "halogen-pure@0.0.2": | |
| 516, | |
| "halogen-renderless@0.0.1": | |
| 590, | |
| "halogen-renderless@0.0.2": | |
| 481, | |
| "halogen-renderless@0.0.3": | |
| 502, | |
| "halogen-renderless@0.0.4": | |
| 54, | |
| "halogen-router@0.1.0": | |
| 214, | |
| "halogen-select@0.2.0": | |
| 979, | |
| "halogen-select@0.3.0": | |
| 795, | |
| "halogen-select@1.0.0": | |
| 816, | |
| "halogen-select@1.0.1": | |
| 818, | |
| "halogen-select@2.0.0": | |
| 654, | |
| "halogen-select@3.0.0": | |
| 524, | |
| "halogen-select@3.0.1": | |
| 519, | |
| "halogen-select@3.0.2": | |
| 534, | |
| "halogen-select@4.0.0": | |
| 540, | |
| "halogen-select@5.0.0": | |
| 459, | |
| "halogen-select@6.0.0": | |
| 315, | |
| "halogen-selects@0.1.0": | |
| -158, | |
| "halogen-selects@0.2.0": | |
| -157, | |
| "halogen-selects@0.2.1": | |
| -179, | |
| "halogen-selects@0.3.0": | |
| -140, | |
| "halogen-selects@0.4.0": | |
| -138, | |
| "halogen-selects@0.5.0": | |
| -259, | |
| "halogen-store@0.1.0": | |
| 179, | |
| "halogen-store@0.1.1": | |
| 172, | |
| "halogen-store@0.1.2": | |
| 220, | |
| "halogen-store@0.2.0": | |
| 218, | |
| "halogen-store@0.2.1": | |
| 208, | |
| "halogen-store@0.3.0": | |
| 216, | |
| "halogen-store@0.4.0": | |
| 261, | |
| "halogen-store@0.4.1": | |
| 331, | |
| "halogen-store@0.5.0": | |
| 354, | |
| "halogen-store@0.5.1": | |
| 288, | |
| "halogen-store@0.5.2": | |
| 297, | |
| "halogen-store@0.5.3": | |
| 297, | |
| "halogen-store@0.5.4": | |
| 299, | |
| "halogen-storybook@0.1.0": | |
| 1029, | |
| "halogen-storybook@0.2.0": | |
| 776, | |
| "halogen-storybook@0.3.0": | |
| 297, | |
| "halogen-storybook@0.4.0": | |
| 305, | |
| "halogen-storybook@1.0.1": | |
| 167, | |
| "halogen-storybook@2.0.0": | |
| 373, | |
| "halogen-subscriptions@1.0.0": | |
| 80, | |
| "halogen-subscriptions@2.0.0": | |
| 60, | |
| "halogen-svg-elems@0.0.2": | |
| 895, | |
| "halogen-svg-elems@0.0.3": | |
| 884, | |
| "halogen-svg-elems@0.0.4": | |
| 895, | |
| "halogen-svg-elems@0.1.0": | |
| 887, | |
| "halogen-svg-elems@2.0.0": | |
| -1221, | |
| "halogen-svg-elems@2.0.1": | |
| 613, | |
| "halogen-svg-elems@2.0.2": | |
| 614, | |
| "halogen-svg-elems@3.0.0": | |
| 232, | |
| "halogen-svg-elems@4.0.0": | |
| 234, | |
| "halogen-svg-elems@5.0.0": | |
| 233, | |
| "halogen-svg-elems@5.0.1": | |
| 361, | |
| "halogen-svg-elems@5.0.2": | |
| 226, | |
| "halogen-svg-elems@5.0.3": | |
| 219, | |
| "halogen-svg-elems@6.0.0": | |
| 236, | |
| "halogen-svg-elems@7.0.0": | |
| 241, | |
| "halogen-vdom@1.0.0": | |
| -283, | |
| "halogen-vdom@1.0.1": | |
| -300, | |
| "halogen-vdom@1.0.2": | |
| -387, | |
| "halogen-vdom@1.0.3": | |
| -297, | |
| "halogen-vdom@1.0.4": | |
| -285, | |
| "halogen-vdom@2.0.0": | |
| 362, | |
| "halogen-vdom@2.0.1": | |
| 583, | |
| "halogen-vdom@3.0.0": | |
| 206, | |
| "halogen-vdom@3.0.1": | |
| 205, | |
| "halogen-vdom@4.0.0": | |
| 206, | |
| "halogen-vdom@5.0.0": | |
| 306, | |
| "halogen-vdom@5.1.0": | |
| 202, | |
| "halogen-vdom@6.0.0": | |
| 188, | |
| "halogen-vdom@6.1.0": | |
| 201, | |
| "halogen-vdom@6.1.1": | |
| 206, | |
| "halogen-vdom@6.1.2": | |
| 203, | |
| "halogen-vdom@6.1.3": | |
| 327, | |
| "halogen-vdom@7.0.0": | |
| 123, | |
| "halogen-vdom@7.0.1": | |
| 128, | |
| "halogen-vdom@8.0.0": | |
| 113, | |
| "halogen-vdom-string-renderer@0.1.0": | |
| -386, | |
| "halogen-vdom-string-renderer@0.2.0": | |
| 665, | |
| "halogen-vdom-string-renderer@0.2.1": | |
| 663, | |
| "halogen-vdom-string-renderer@0.2.2": | |
| 801, | |
| "halogen-vdom-string-renderer@0.3.0": | |
| 230, | |
| "halogen-vdom-string-renderer@0.3.1": | |
| 230, | |
| "halogen-vdom-string-renderer@0.5.0": | |
| 122, | |
| "halogen-virtual-dom@1.0.0": | |
| -600, | |
| "halogen-virtual-dom@2.0.0": | |
| 1243, | |
| "handlebars@0.1.0": | |
| 89, | |
| "handlebars@1.0.0": | |
| 102, | |
| "handlebars@2.0.0": | |
| 44, | |
| "handsontable@0.1.0": | |
| 259, | |
| "handsontable@0.1.1": | |
| 98, | |
| "handsontable@0.2.0": | |
| 100, | |
| "handsontable@1.0.0": | |
| -332, | |
| "handsontable@2.0.0": | |
| -411, | |
| "handsontable@3.0.0": | |
| 680, | |
| "hareactive@0.0.1": | |
| 64, | |
| "hareactive@0.0.2": | |
| 77, | |
| "hareactive@0.0.3": | |
| 72, | |
| "hareactive@0.0.4": | |
| 269, | |
| "hareactive@0.0.5": | |
| 175, | |
| "hareactive@0.0.6": | |
| 173, | |
| "hareactive@0.0.7": | |
| 183, | |
| "hareactive@0.0.8": | |
| 187, | |
| "hareactive@0.0.9": | |
| 259, | |
| "hareactive@0.1.0": | |
| 204, | |
| "hareactive@0.1.1": | |
| 301, | |
| "hareactive@0.1.2": | |
| 306, | |
| "has-js-rep@0.1.0": | |
| 240, | |
| "hash@0.1.0": | |
| 69, | |
| "hash@0.1.1": | |
| 74, | |
| "hash@0.1.2": | |
| 75, | |
| "hash@0.2.0": | |
| 144, | |
| "hash@0.2.1": | |
| 69, | |
| "hash@1.0.0": | |
| 142, | |
| "hash@1.1.0": | |
| 121, | |
| "hash@1.1.1": | |
| 134, | |
| "hash@1.3.0": | |
| 128, | |
| "haskell-iso@0.0.0": | |
| 348, | |
| "haskell-iso@0.0.1": | |
| 443, | |
| "haskell-iso@0.0.2": | |
| 335, | |
| "haskell-iso@0.0.3": | |
| 326, | |
| "heap@0.1.0": | |
| 66, | |
| "heckin@1.0.0": | |
| 136, | |
| "heckin@1.0.1": | |
| 127, | |
| "heckin@1.0.2": | |
| 126, | |
| "heckin@1.0.3": | |
| 128, | |
| "heckin@1.1.0": | |
| 234, | |
| "heckin@2.0.0": | |
| 83, | |
| "heckin@2.0.1": | |
| 83, | |
| "heterogeneous@0.1.0": | |
| 82, | |
| "heterogeneous@0.2.0": | |
| 116, | |
| "heterogeneous@0.3.0": | |
| 109, | |
| "heterogeneous@0.4.0": | |
| 115, | |
| "heterogeneous@0.4.1": | |
| 199, | |
| "heterogeneous@0.5.0": | |
| 74, | |
| "heterogeneous@0.5.1": | |
| 72, | |
| "heterogeneous@0.6.0": | |
| 76, | |
| "heterogeneous-extrablatt@0.1.0": | |
| 103, | |
| "heterogeneous-extrablatt@0.2.1": | |
| 88, | |
| "heterogeneous-extrablatt@1.0.0": | |
| 158, | |
| "heterogeneous-extrablatt@1.0.1": | |
| 88, | |
| "hetu@0.2.0": | |
| -244, | |
| "higher-order@0.1.0": | |
| 115, | |
| "higher-order@0.1.1": | |
| 142, | |
| "higher-order@0.2.0": | |
| 140, | |
| "hoist@1.0.0": | |
| 72, | |
| "hoist@2.0.0": | |
| 63, | |
| "hoist@3.0.0": | |
| 190, | |
| "hoist@4.0.0": | |
| 116, | |
| "home-run-ball@0.1.0": | |
| 116, | |
| "home-run-ball@0.2.0": | |
| 158, | |
| "home-run-ball@1.0.0": | |
| 121, | |
| "homogeneous@0.2.0": | |
| 116, | |
| "homogeneous@0.3.0": | |
| 102, | |
| "homogeneous@0.4.0": | |
| 1858, | |
| "homogeneous-objects@1.0.0": | |
| 164, | |
| "homogeneous-objects@2.0.0": | |
| 66, | |
| "homogeneous-objects@3.0.0": | |
| 221, | |
| "homogeneous-objects@4.0.0": | |
| 385, | |
| "hot-shots@0.0.1": | |
| 269, | |
| "hot-shots@0.0.2": | |
| 271, | |
| "hotteok@0.1.0": | |
| 359, | |
| "hotteok@1.0.0": | |
| 179, | |
| "hotteok@1.0.1": | |
| 167, | |
| "howl@0.1.0": | |
| 167, | |
| "howl@0.2.0": | |
| 118, | |
| "howler@0.2.0": | |
| 55, | |
| "howler@0.3.0": | |
| 78, | |
| "howler@0.4.0": | |
| 67, | |
| "html@0.1.0": | |
| 100, | |
| "html@0.1.1": | |
| 100, | |
| "html@0.2.0": | |
| 43, | |
| "html@0.3.0": | |
| 54, | |
| "html@0.4.0": | |
| 72, | |
| "html@0.5.0": | |
| 65, | |
| "html@0.6.0": | |
| 66, | |
| "html@0.6.1": | |
| 66, | |
| "html@0.6.2": | |
| 68, | |
| "html@0.6.3": | |
| 124, | |
| "html@0.6.4": | |
| 49, | |
| "html@0.6.5": | |
| 59, | |
| "html@0.6.6": | |
| 69, | |
| "html@0.6.7": | |
| 75, | |
| "html@0.6.8": | |
| 68, | |
| "html@0.6.9": | |
| 128, | |
| "html@0.7.0": | |
| 50, | |
| "html@0.8.0": | |
| 59, | |
| "html@0.9.0": | |
| 72, | |
| "html@0.9.1": | |
| 73, | |
| "html@0.10.0": | |
| 76, | |
| "html@0.10.1": | |
| 149, | |
| "html-codegen-halogen@0.0.1": | |
| 260, | |
| "html-parser@1.0.0": | |
| -160, | |
| "html-parser@1.0.1": | |
| -166, | |
| "html-parser@1.0.2": | |
| -177, | |
| "html-parser-halogen@0.1.0": | |
| 787, | |
| "html-parser-halogen@0.2.0": | |
| 771, | |
| "html-parser-halogen@0.3.0": | |
| 517, | |
| "html-parser-halogen@1.0.0": | |
| 181, | |
| "html-parser-halogen@1.1.0": | |
| 176, | |
| "http@0.1.0": | |
| 52, | |
| "http@0.2.0": | |
| 75, | |
| "http@0.3.0": | |
| 63, | |
| "http@0.4.0": | |
| 79, | |
| "http@1.0.0": | |
| 87, | |
| "http@2.0.0": | |
| 125, | |
| "http@3.0.0": | |
| 51, | |
| "http@4.0.0": | |
| 65, | |
| "http-methods@0.1.0": | |
| 102, | |
| "http-methods@0.1.1": | |
| 92, | |
| "http-methods@1.0.0": | |
| 81, | |
| "http-methods@2.0.0": | |
| 128, | |
| "http-methods@3.0.0": | |
| 209, | |
| "http-methods@4.0.0": | |
| 235, | |
| "http-methods@4.0.1": | |
| 108, | |
| "http-methods@4.0.2": | |
| 103, | |
| "http-methods@5.0.0": | |
| 87, | |
| "http-methods@6.0.0": | |
| 93, | |
| "http-types@0.1.0": | |
| 184, | |
| "http-types@0.2.0": | |
| 186, | |
| "http-types@0.2.1": | |
| 274, | |
| "http-types@0.3.0": | |
| 181, | |
| "http-types@0.4.0": | |
| 131, | |
| "http-types@0.5.0": | |
| 256, | |
| "http-types@0.6.0": | |
| 392, | |
| "http-types@0.6.1": | |
| 399, | |
| "http-types-basic@0.0.0": | |
| 147, | |
| "http-types-basic@0.0.1": | |
| 155, | |
| "http-types-basic@0.0.2": | |
| 244, | |
| "http-types-basic@0.0.3": | |
| 132, | |
| "http-types-basic@0.0.4": | |
| 135, | |
| "http-types-basic@0.0.5": | |
| 145, | |
| "httpure@0.1.0": | |
| 527, | |
| "httpure@0.2.0": | |
| 518, | |
| "httpure@0.3.0": | |
| 679, | |
| "httpure@0.4.0": | |
| 422, | |
| "httpure@0.4.1": | |
| 408, | |
| "httpure@0.5.0": | |
| 423, | |
| "httpure@0.6.0": | |
| 427, | |
| "httpure@0.6.1": | |
| 537, | |
| "httpure@0.6.2": | |
| 422, | |
| "httpure@0.6.3": | |
| 410, | |
| "httpure@0.7.0": | |
| 305, | |
| "httpure@0.7.1": | |
| 302, | |
| "httpure@0.8.0": | |
| 428, | |
| "httpure@0.8.1": | |
| 557, | |
| "httpure@0.8.2": | |
| 401, | |
| "httpure@0.8.3": | |
| 404, | |
| "httpure@0.9.0": | |
| 417, | |
| "httpure@0.10.0": | |
| 419, | |
| "httpure@0.11.0": | |
| 464, | |
| "httpure@0.12.0": | |
| 162, | |
| "httpure@0.13.0": | |
| 239, | |
| "httpure@0.13.1": | |
| 145, | |
| "httpure@0.14.0": | |
| 145, | |
| "httpure@0.15.0": | |
| 136, | |
| "httpure@0.16.0": | |
| 138, | |
| "httpure-contrib-biscotti@0.1.0": | |
| 732, | |
| "httpure-contrib-biscotti@0.1.1": | |
| 609, | |
| "httpure-contrib-biscotti@0.1.2": | |
| 511, | |
| "httpure-contrib-biscotti@0.2.0": | |
| 1100, | |
| "httpure-middleware@1.0.0": | |
| 521, | |
| "httpure-middleware@1.1.0": | |
| 641, | |
| "httpure-middleware@1.2.0": | |
| 494, | |
| "httpure-middleware@1.2.1": | |
| 494, | |
| "httpure-middleware@2.0.0": | |
| 497, | |
| "httpure-middleware@2.1.0": | |
| 502, | |
| "httpure-middleware@3.0.0": | |
| 606, | |
| "httpure-middleware@4.0.0": | |
| 128, | |
| "httpure-middleware@4.0.1": | |
| 126, | |
| "httpurple@0.1.0": | |
| 522, | |
| "httpurple@0.2.0": | |
| 520, | |
| "httpurple@0.3.0": | |
| 558, | |
| "httpurple@0.4.0": | |
| 440, | |
| "httpurple@0.4.1": | |
| 541, | |
| "httpurple@0.5.0": | |
| 423, | |
| "httpurple@0.6.0": | |
| 413, | |
| "httpurple@0.6.1": | |
| 421, | |
| "httpurple@0.6.2": | |
| 431, | |
| "httpurple@0.6.3": | |
| 425, | |
| "httpurple@0.7.0": | |
| 303, | |
| "httpurple@0.7.1": | |
| 412, | |
| "httpurple@0.8.0": | |
| 301, | |
| "httpurple@0.8.1": | |
| 398, | |
| "httpurple@0.8.2": | |
| 406, | |
| "httpurple@0.8.3": | |
| 414, | |
| "httpurple@0.9.0": | |
| 415, | |
| "httpurple@0.10.0": | |
| 417, | |
| "httpurple@0.11.0": | |
| 1228, | |
| "httpurple@0.12.0": | |
| 147, | |
| "httpurple@1.0.0": | |
| 110, | |
| "httpurple@1.1.0": | |
| 120, | |
| "httpurple@1.2.0": | |
| 130, | |
| "httpurple@1.2.1": | |
| 127, | |
| "httpurple@1.3.0": | |
| 131, | |
| "httpurple@2.0.0": | |
| 125, | |
| "httpurple@3.0.0": | |
| 214, | |
| "httpurple@3.0.1": | |
| 104, | |
| "httpurple-argonaut@1.0.1": | |
| 142, | |
| "httpurple-yoga-json@1.0.0": | |
| 144, | |
| "huffman@0.2.0": | |
| 145, | |
| "huffman@0.2.1": | |
| 117, | |
| "hugenums@1.0.0": | |
| 141, | |
| "hugenums@1.0.1": | |
| 65, | |
| "hugenums@1.1.0": | |
| 51, | |
| "hugenums@1.2.0": | |
| 63, | |
| "hugenums@1.2.1": | |
| 73, | |
| "hugenums@1.3.0": | |
| 83, | |
| "hugenums@1.3.1": | |
| 83, | |
| "hugenums@1.3.2": | |
| 86, | |
| "hugenums@1.4.0": | |
| 163, | |
| "hugenums@2.0.0": | |
| 81, | |
| "hugenums@2.0.1": | |
| 52, | |
| "hyper@0.1.0": | |
| -569, | |
| "hyper@0.1.1": | |
| -570, | |
| "hyper@0.1.2": | |
| -578, | |
| "hyper@0.1.3": | |
| -574, | |
| "hyper@0.1.4": | |
| -662, | |
| "hyper@0.1.5": | |
| -549, | |
| "hyper@0.2.0": | |
| -560, | |
| "hyper@0.3.0": | |
| -584, | |
| "hyper@0.4.0": | |
| -585, | |
| "hyper@0.4.1": | |
| -585, | |
| "hyper@0.5.0": | |
| -671, | |
| "hyper@0.6.0": | |
| -547, | |
| "hyper@0.7.0": | |
| 792, | |
| "hyper@0.7.1": | |
| 800, | |
| "hyper@0.7.2": | |
| 823, | |
| "hyper@0.7.3": | |
| 806, | |
| "hyper@0.8.0": | |
| 913, | |
| "hyper@0.9.0": | |
| 463, | |
| "hyper@0.9.1": | |
| 447, | |
| "hyper@0.10.0": | |
| -428, | |
| "hyper@0.10.1": | |
| -410, | |
| "hyper@0.11.0": | |
| 377, | |
| "hyper@0.11.1": | |
| 382, | |
| "hyper-sslify@0.1.0": | |
| 1065, | |
| "hyper-sslify@0.1.1": | |
| 872, | |
| "hyper-sslify@0.1.2": | |
| 893, | |
| "hyperdrive@0.1.0": | |
| 1001, | |
| "hypertrout@0.8.0": | |
| 1064, | |
| "hypertrout@0.8.1": | |
| 1181, | |
| "hypertrout@0.9.0": | |
| 1011, | |
| "hypertrout@0.10.0": | |
| 635, | |
| "hypertrout@0.11.0": | |
| -568, | |
| "hypertrout@0.11.1": | |
| 575, | |
| "hyrule@1.0.0": | |
| 180, | |
| "hyrule@1.1.0": | |
| 201, | |
| "hyrule@1.2.0": | |
| 380, | |
| "hyrule@1.2.1": | |
| 238, | |
| "hyrule@1.2.2": | |
| 232, | |
| "hyrule@1.2.3": | |
| 247, | |
| "hyrule@1.2.4": | |
| 249, | |
| "hyrule@1.3.0": | |
| 249, | |
| "hyrule@1.4.0": | |
| 121, | |
| "hyrule@1.4.1": | |
| 226, | |
| "hyrule@1.4.2": | |
| 111, | |
| "hyrule@1.5.0": | |
| 95, | |
| "hyrule@1.5.1": | |
| 102, | |
| "hyrule@1.6.0": | |
| 113, | |
| "hyrule@1.6.1": | |
| 115, | |
| "hyrule@1.6.2": | |
| 124, | |
| "hyrule@1.6.3": | |
| 100, | |
| "hyrule@1.6.4": | |
| 210, | |
| "hyrule@1.6.5": | |
| 92, | |
| "hyrule@1.6.6": | |
| 94, | |
| "hyrule@1.6.7": | |
| 100, | |
| "hyrule@1.6.8": | |
| 108, | |
| "hyrule@1.6.9": | |
| 111, | |
| "hyrule@2.0.0": | |
| 123, | |
| "hyrule@2.0.6": | |
| 247, | |
| "hyrule@2.0.7": | |
| 112, | |
| "hyrule@2.0.8": | |
| 107, | |
| "hyrule@2.1.0": | |
| 126, | |
| "hyrule@2.2.0": | |
| 123, | |
| "hyrule@2.3.0": | |
| 125, | |
| "hyrule@2.3.1": | |
| 125, | |
| "hyrule@2.3.2": | |
| 210, | |
| "hyrule@2.3.3": | |
| 115, | |
| "ide-purescript-core@0.7.0": | |
| 790, | |
| "ide-purescript-core@0.7.1": | |
| 796, | |
| "ide-purescript-core@0.8.0": | |
| 800, | |
| "ide-purescript-core@0.8.1": | |
| 808, | |
| "ide-purescript-core@0.8.2": | |
| 905, | |
| "ide-purescript-core@0.9.0": | |
| 779, | |
| "ide-purescript-core@0.9.1": | |
| 778, | |
| "ide-purescript-core@0.10.0": | |
| 867, | |
| "ide-purescript-core@0.10.1": | |
| 871, | |
| "ide-purescript-core@0.10.2": | |
| 869, | |
| "ide-purescript-core@0.10.3": | |
| 970, | |
| "ide-purescript-core@0.10.4": | |
| 835, | |
| "ide-purescript-core@0.11.0": | |
| 848, | |
| "ide-purescript-core@0.12.0": | |
| 872, | |
| "ide-purescript-core@0.12.1": | |
| 947, | |
| "ide-purescript-core@0.13.0": | |
| 853, | |
| "ide-purescript-core@0.14.0": | |
| 829, | |
| "ide-purescript-core@0.15.0": | |
| 931, | |
| "ide-purescript-core@0.16.0": | |
| 947, | |
| "ide-purescript-core@0.16.1": | |
| 950, | |
| "identity@0.1.0": | |
| 119, | |
| "identity@0.2.0": | |
| 79, | |
| "identity@0.3.0": | |
| 49, | |
| "identity@0.4.0": | |
| 56, | |
| "identity@0.4.1": | |
| 75, | |
| "identity@1.0.0": | |
| 60, | |
| "identity@1.1.0": | |
| 72, | |
| "identity@2.0.0": | |
| 77, | |
| "identity@2.1.0": | |
| 84, | |
| "identity@3.0.0": | |
| 96, | |
| "identity@3.1.0": | |
| 59, | |
| "identity@4.0.0": | |
| 50, | |
| "identity@4.1.0": | |
| 75, | |
| "identity@5.0.0": | |
| 66, | |
| "identity@6.0.0": | |
| 115, | |
| "identy@1.0.0": | |
| 280, | |
| "identy@2.0.0": | |
| 224, | |
| "identy@2.0.1": | |
| 210, | |
| "identy@2.0.2": | |
| 196, | |
| "identy@2.1.0": | |
| 197, | |
| "identy@2.2.0": | |
| 327, | |
| "identy@3.0.0": | |
| 131, | |
| "identy@4.0.0": | |
| 102, | |
| "identy@4.0.1": | |
| 94, | |
| "idiomatic-node-buffer@0.1.0": | |
| 279, | |
| "idiomatic-node-buffer@0.2.0": | |
| 270, | |
| "idiomatic-node-buffer@0.4.0": | |
| 184, | |
| "idiomatic-node-buffer@0.4.1": | |
| 194, | |
| "idiomatic-node-crypto@0.2.0": | |
| 318, | |
| "idiomatic-node-crypto@0.2.1": | |
| 202, | |
| "idiomatic-node-errors@0.3.0": | |
| 42, | |
| "idiomatic-node-errors@0.3.1": | |
| 69, | |
| "idiomatic-node-events@0.4.0": | |
| 187, | |
| "idiomatic-node-events@0.4.1": | |
| 181, | |
| "idiomatic-node-http@0.4.0": | |
| 277, | |
| "idiomatic-node-http@0.4.1": | |
| 182, | |
| "idiomatic-node-process@0.3.0": | |
| 43, | |
| "idiomatic-node-process@0.3.1": | |
| 55, | |
| "idiomatic-node-server@0.1.0": | |
| -241, | |
| "idiomatic-node-server@0.2.0": | |
| -231, | |
| "idiomatic-node-server@0.3.0": | |
| -229, | |
| "idiomatic-node-server@0.5.0": | |
| 202, | |
| "idiomatic-node-server@0.5.1": | |
| 338, | |
| "idiomatic-node-stream@0.2.0": | |
| -361, | |
| "idiomatic-node-stream@0.3.0": | |
| -356, | |
| "idiomatic-node-stream@0.6.0": | |
| 187, | |
| "idiomatic-node-stream@0.6.1": | |
| 191, | |
| "ifrit@0.1.0": | |
| -223, | |
| "ifrit@0.1.1": | |
| -220, | |
| "ifrit@0.1.2": | |
| -225, | |
| "ifrit@0.1.3": | |
| -319, | |
| "imagediff@0.1.0": | |
| 77, | |
| "imagediff@0.2.0": | |
| 69, | |
| "imagediff@0.3.0": | |
| 86, | |
| "imagediff@0.4.0": | |
| 76, | |
| "impulse@1.0.0": | |
| 66, | |
| "impulse@1.0.1": | |
| 91, | |
| "impulse@1.1.0": | |
| 127, | |
| "impulse@1.2.0": | |
| 70, | |
| "impulse@1.3.0": | |
| 76, | |
| "impulse@1.3.1": | |
| 86, | |
| "impulse@2.0.0": | |
| 272, | |
| "impulse@2.0.1": | |
| 274, | |
| "impulse@2.0.2": | |
| 268, | |
| "impulse@2.0.3": | |
| 273, | |
| "impulse@2.1.0": | |
| 363, | |
| "impulse@2.1.1": | |
| 257, | |
| "impulse@2.2.0": | |
| 264, | |
| "impulse@2.2.1": | |
| 271, | |
| "impulse@3.0.0": | |
| 296, | |
| "impur@0.0.1": | |
| 679, | |
| "impur@0.0.2": | |
| 647, | |
| "impur@0.0.3": | |
| 656, | |
| "impur@0.0.4": | |
| 662, | |
| "impur@0.0.5": | |
| 660, | |
| "impur@0.0.6": | |
| 666, | |
| "incremental@0.1.0": | |
| 190, | |
| "incremental@0.2.0": | |
| 90, | |
| "incremental@0.3.0": | |
| 82, | |
| "incremental-dom@0.1.0": | |
| 563, | |
| "incremental-functions@0.1.0": | |
| 155, | |
| "incremental-functions@0.2.0": | |
| 381, | |
| "incremental-functions@0.2.1": | |
| 512, | |
| "incremental-functions@1.0.0": | |
| 264, | |
| "incremental-functions@1.1.0": | |
| 259, | |
| "incremental-functions@1.1.1": | |
| 273, | |
| "incremental-functions@1.1.2": | |
| 276, | |
| "incremental-functions@1.2.0": | |
| 278, | |
| "incremental-functions@1.2.1": | |
| 283, | |
| "incremental-functions@1.3.0": | |
| 388, | |
| "incremental-functions@1.4.0": | |
| 278, | |
| "incremental-functions@1.5.0": | |
| 264, | |
| "incremental-functions@2.0.0": | |
| 148, | |
| "index@0.1.0": | |
| -70, | |
| "index@0.2.0": | |
| 73, | |
| "index@0.3.0": | |
| 85, | |
| "index@0.4.0": | |
| 95, | |
| "indexed@0.0.1": | |
| 120, | |
| "indexed@0.0.2": | |
| 62, | |
| "indexed-monad@0.1.0": | |
| -167, | |
| "indexed-monad@0.1.1": | |
| -138, | |
| "indexed-monad@0.2.0": | |
| 457, | |
| "indexed-monad@0.3.0": | |
| 433, | |
| "indexed-monad@1.0.0": | |
| 59, | |
| "indexed-monad@1.1.0": | |
| 74, | |
| "indexed-monad@1.2.0": | |
| 113, | |
| "indexed-monad@2.0.0": | |
| 43, | |
| "indexed-monad@2.0.1": | |
| 55, | |
| "indexed-monad@2.1.0": | |
| 72, | |
| "indexed-nonempty@0.0.1": | |
| 322, | |
| "indexed-nonempty@0.1.0": | |
| 363, | |
| "indexed-nonempty@1.0.0": | |
| 89, | |
| "indexeddb@1.0.0": | |
| 412, | |
| "indexeddb@1.0.1": | |
| 414, | |
| "indexeddb@1.0.2": | |
| 425, | |
| "indexeddb@2.0.0": | |
| 515, | |
| "indexeddb@2.0.1": | |
| 517, | |
| "indexeddb@3.0.0": | |
| 519, | |
| "indexeddb@4.0.0": | |
| 625, | |
| "inefficiency@0.0.1": | |
| 39, | |
| "infinite-list@0.1.0": | |
| 118, | |
| "infinite-list@0.2.0": | |
| 159, | |
| "infinite-list@0.2.1": | |
| 158, | |
| "infinite-list@0.2.2": | |
| 250, | |
| "infinite-lists@1.0.0": | |
| 51, | |
| "infinite-lists@1.1.0": | |
| 63, | |
| "infinite-lists@2.0.0": | |
| 71, | |
| "infinite-lists@3.0.0": | |
| 70, | |
| "infinite-lists@3.1.0": | |
| 74, | |
| "infinite-lists@3.2.0": | |
| 152, | |
| "inflection@0.0.0": | |
| 70, | |
| "inflection@1.0.0": | |
| 49, | |
| "inflection@1.0.1": | |
| 55, | |
| "information@2.0.1": | |
| 263, | |
| "information@2.0.2": | |
| 224, | |
| "information@2.0.3": | |
| 228, | |
| "inject@0.0.2": | |
| 67, | |
| "inject@0.1.0": | |
| 176, | |
| "inject@0.2.0": | |
| 68, | |
| "inject@0.2.1": | |
| 80, | |
| "inject@0.3.0": | |
| 67, | |
| "inject@1.0.0": | |
| 65, | |
| "inject@2.0.0": | |
| 97, | |
| "inject@3.0.0": | |
| 88, | |
| "inject@4.0.0": | |
| 179, | |
| "inject@4.0.1": | |
| 130, | |
| "int-53@0.0.0": | |
| 53, | |
| "int-53@0.0.1": | |
| 66, | |
| "int-53@1.0.0": | |
| 67, | |
| "int-53@1.1.0": | |
| 68, | |
| "int-53@2.0.0": | |
| 71, | |
| "int-53@2.0.1": | |
| 115, | |
| "int-53@2.1.0": | |
| 57, | |
| "int-53@2.1.1": | |
| 107, | |
| "int-53@3.0.0": | |
| 252, | |
| "int-53@4.0.0": | |
| 65, | |
| "int64@1.0.0": | |
| 99, | |
| "int64@2.0.0": | |
| 152, | |
| "integers@0.0.1": | |
| 37, | |
| "integers@0.1.0": | |
| 53, | |
| "integers@0.2.0": | |
| 74, | |
| "integers@0.2.1": | |
| 69, | |
| "integers@1.0.0": | |
| 97, | |
| "integers@1.1.0": | |
| 95, | |
| "integers@2.0.0": | |
| 46, | |
| "integers@2.1.0": | |
| 53, | |
| "integers@2.1.1": | |
| 78, | |
| "integers@3.0.0": | |
| 71, | |
| "integers@3.1.0": | |
| 63, | |
| "integers@3.2.0": | |
| 75, | |
| "integers@4.0.0": | |
| 70, | |
| "integers@5.0.0": | |
| 125, | |
| "integers@6.0.0": | |
| 50, | |
| "interpolate@1.0.0": | |
| 54, | |
| "interpolate@2.0.0": | |
| 59, | |
| "interpolate@2.0.1": | |
| 73, | |
| "interpolate@3.0.0": | |
| 59, | |
| "interpolate@3.0.1": | |
| 73, | |
| "interpolate@4.0.0": | |
| 136, | |
| "interpolate@5.0.0": | |
| 46, | |
| "interpolate@5.0.1": | |
| 51, | |
| "interpolate@5.0.2": | |
| 62, | |
| "intertwine@0.0.1": | |
| 231, | |
| "intertwine@0.0.2": | |
| 198, | |
| "intertwine@0.0.3": | |
| 177, | |
| "intertwine@0.0.4": | |
| 178, | |
| "intertwine@0.1.0": | |
| 212, | |
| "intertwine@0.1.1": | |
| 295, | |
| "intertwine@0.1.2": | |
| 190, | |
| "intertwine@0.2.0": | |
| 184, | |
| "intertwine@0.2.1": | |
| 200, | |
| "intertwine@0.2.2": | |
| 205, | |
| "intertwine@0.2.3": | |
| 288, | |
| "intertwine@0.2.4": | |
| 195, | |
| "intertwine@0.3.0": | |
| 187, | |
| "intertwine@0.4.0": | |
| 188, | |
| "intertwine@0.4.1": | |
| 203, | |
| "intertwine@0.4.2": | |
| 202, | |
| "intervals@0.0.1": | |
| 269, | |
| "intervals@1.0.0": | |
| 239, | |
| "intervals@2.0.0": | |
| 349, | |
| "intervals@2.0.1": | |
| 234, | |
| "intervals@3.0.0": | |
| 229, | |
| "intervals@3.1.0": | |
| 237, | |
| "intervals@3.2.0": | |
| 242, | |
| "intervals@4.0.0": | |
| 106, | |
| "intl@0.1.0": | |
| 397, | |
| "intl@0.1.1": | |
| 493, | |
| "intl@0.2.0": | |
| 371, | |
| "intl@0.3.0": | |
| 362, | |
| "intl@0.4.0": | |
| 382, | |
| "intl@0.4.1": | |
| 380, | |
| "intl@0.4.2": | |
| 380, | |
| "intmap@1.0.0": | |
| 628, | |
| "intmap@1.0.1": | |
| 504, | |
| "intmaps@1.1.2": | |
| 47, | |
| "intmaps@1.1.3": | |
| 64, | |
| "invariant@0.1.0": | |
| 71, | |
| "invariant@0.2.0": | |
| 60, | |
| "invariant@0.3.0": | |
| 78, | |
| "invariant@1.0.0": | |
| 114, | |
| "invariant@2.0.0": | |
| 45, | |
| "invariant@3.0.0": | |
| 53, | |
| "invariant@4.0.0": | |
| 58, | |
| "invariant@4.1.0": | |
| 71, | |
| "invariant@5.0.0": | |
| 62, | |
| "invariant@6.0.0": | |
| 134, | |
| "invertible-syntax@1.0.0": | |
| 149, | |
| "io-lists@0.0.1": | |
| 178, | |
| "io-lists@0.0.2": | |
| 190, | |
| "io-lists@0.0.3": | |
| 187, | |
| "io-lists@0.0.4": | |
| 194, | |
| "ipfs-api@0.0.1": | |
| 505, | |
| "ipfs-api@0.0.2": | |
| 507, | |
| "ipfs-api@0.0.3": | |
| 630, | |
| "ipfs-api@0.0.4": | |
| 535, | |
| "isometric@0.1.0": | |
| 86, | |
| "isometric@0.2.0": | |
| -88, | |
| "isometric@1.0.0": | |
| 81, | |
| "isometric@2.0.0": | |
| 350, | |
| "isometric@3.0.0": | |
| 253, | |
| "isomorphisms@2.0.0": | |
| 43, | |
| "isomorphisms@3.0.0": | |
| 74, | |
| "isomorphisms@4.0.0": | |
| 98, | |
| "isomorphisms@5.0.0": | |
| 79, | |
| "isotypes@0.1.0": | |
| 80, | |
| "isotypes@0.1.1": | |
| 80, | |
| "isotypes@1.0.0": | |
| 474, | |
| "iterable@1.0.0": | |
| 51, | |
| "iterable@2.0.0": | |
| 171, | |
| "jack@0.0.1": | |
| 90, | |
| "jack@0.0.2": | |
| 104, | |
| "jack@0.1.0": | |
| 105, | |
| "jack@0.2.0": | |
| 106, | |
| "jack@1.0.0": | |
| 188, | |
| "jack@2.0.0": | |
| 348, | |
| "jack@3.0.0": | |
| 110, | |
| "jajanmen@0.1.0": | |
| 313, | |
| "jajanmen@0.2.0": | |
| 316, | |
| "jajanmen@1.0.0": | |
| 322, | |
| "jarilo@0.4.0": | |
| 309, | |
| "jarilo@0.5.0": | |
| 415, | |
| "jarilo@0.5.1": | |
| 311, | |
| "jarilo@0.5.2": | |
| 290, | |
| "jarilo@0.5.3": | |
| 403, | |
| "jarilo@1.0.0": | |
| 130, | |
| "jarilo@1.0.1": | |
| 130, | |
| "jaws@0.1.0": | |
| 191, | |
| "jaws@0.1.1": | |
| 194, | |
| "jaws@0.1.2": | |
| 301, | |
| "jaws@0.1.3": | |
| 182, | |
| "jaws@0.1.4": | |
| 172, | |
| "jaws@0.1.5": | |
| 188, | |
| "jaws@0.1.6": | |
| 190, | |
| "jaws@0.1.7": | |
| 190, | |
| "jaws@0.1.8": | |
| 295, | |
| "jaws@0.1.9": | |
| 189, | |
| "jaws@0.2.0": | |
| 174, | |
| "jaws@0.2.1": | |
| 165, | |
| "jaws@0.2.2": | |
| 177, | |
| "jaws@0.2.3": | |
| 178, | |
| "jelly@0.1.0": | |
| -268, | |
| "jelly@0.1.1": | |
| -267, | |
| "jelly@0.2.0": | |
| -380, | |
| "jelly@0.3.1": | |
| -251, | |
| "jelly@0.4.0": | |
| -248, | |
| "jelly@0.4.1": | |
| -260, | |
| "jelly@0.5.0": | |
| 132, | |
| "jelly@0.6.0": | |
| 119, | |
| "jelly@0.6.1": | |
| 118, | |
| "jelly@0.6.2": | |
| 227, | |
| "jelly@0.6.3": | |
| 108, | |
| "jelly@0.7.0": | |
| 92, | |
| "jelly@0.8.0": | |
| 101, | |
| "jelly@0.8.1": | |
| 117, | |
| "jelly@0.9.0": | |
| -276, | |
| "jelly-hooks@0.1.0": | |
| 100, | |
| "jelly-hooks@0.2.0": | |
| 101, | |
| "jelly-hooks@0.2.1": | |
| 193, | |
| "jelly-hooks@0.3.0": | |
| -86, | |
| "jelly-router@0.1.0": | |
| 103, | |
| "jelly-router@0.1.1": | |
| 126, | |
| "jelly-router@0.2.1": | |
| -295, | |
| "jelly-signal@0.1.0": | |
| 60, | |
| "jelly-signal@0.2.0": | |
| 72, | |
| "jelly-signal@0.3.0": | |
| 109, | |
| "jest@0.1.0": | |
| 50, | |
| "jest@0.2.0": | |
| 52, | |
| "jest@0.2.1": | |
| 57, | |
| "jest@0.3.0": | |
| 417, | |
| "jest@0.4.0": | |
| 356, | |
| "jest@0.5.0": | |
| 273, | |
| "jest@1.0.0": | |
| 3403, | |
| "jolly-pong@0.1.0": | |
| 206, | |
| "jolly-pong@0.2.0": | |
| 221, | |
| "jolly-pong@1.0.0": | |
| 186, | |
| "jquery@0.2.0": | |
| -54, | |
| "jquery@0.2.1": | |
| -71, | |
| "jquery@0.2.2": | |
| -130, | |
| "jquery@0.2.3": | |
| -56, | |
| "jquery@0.3.0": | |
| 70, | |
| "jquery@0.4.0": | |
| 71, | |
| "jquery@0.5.0": | |
| 91, | |
| "jquery@0.6.0": | |
| 109, | |
| "jquery@0.6.1": | |
| 109, | |
| "jquery@1.0.0": | |
| 80, | |
| "jquery@2.0.0": | |
| -347, | |
| "jquery@3.0.0": | |
| 391, | |
| "jquery@3.1.0": | |
| -322, | |
| "jquery@4.0.0": | |
| 429, | |
| "jquery@4.1.0": | |
| 708, | |
| "jquery@4.2.0": | |
| 694, | |
| "jquery@4.2.1": | |
| 885, | |
| "jquery@4.3.0": | |
| 680, | |
| "jquery@5.0.0": | |
| 260, | |
| "jquery-fancy@0.0.1": | |
| 696, | |
| "jquery-fancy@0.1.0": | |
| 705, | |
| "jquery-fancy@0.2.0": | |
| 705, | |
| "jquery-fancy@0.3.0": | |
| 709, | |
| "jquery-fancy@1.0.0": | |
| 404, | |
| "jquery-fancy@2.0.0": | |
| 305, | |
| "jquery-slider@0.1.0": | |
| 101, | |
| "jquery-slider@0.2.0": | |
| 106, | |
| "js@0.1.0": | |
| 66, | |
| "js@0.1.1": | |
| 76, | |
| "js@0.1.2": | |
| 72, | |
| "js-barcode@0.1.0": | |
| -224, | |
| "js-barcode@1.0.0": | |
| 641, | |
| "js-barcode@1.0.1": | |
| 490, | |
| "js-barcode@1.0.2": | |
| 483, | |
| "js-barcode-halogen@0.1.0": | |
| -263, | |
| "js-barcode-halogen@0.2.0": | |
| -270, | |
| "js-barcode-halogen@1.0.0": | |
| -751, | |
| "js-barcode-halogen@1.0.1": | |
| -747, | |
| "js-barcode-halogen@2.0.0": | |
| -817, | |
| "js-bigints@1.0.1": | |
| 74, | |
| "js-bigints@1.1.0": | |
| 76, | |
| "js-bigints@1.2.0": | |
| 92, | |
| "js-cookie@0.0.0": | |
| 826, | |
| "js-date@1.0.0": | |
| 65, | |
| "js-date@1.1.0": | |
| 145, | |
| "js-date@1.2.0": | |
| 61, | |
| "js-date@2.0.0": | |
| 252, | |
| "js-date@3.0.0": | |
| 181, | |
| "js-date@4.0.0": | |
| 244, | |
| "js-date@5.0.0": | |
| 243, | |
| "js-date@5.0.1": | |
| 484, | |
| "js-date@5.1.0": | |
| 402, | |
| "js-date@5.2.0": | |
| 388, | |
| "js-date@6.0.0": | |
| 199, | |
| "js-date@7.0.0": | |
| 123, | |
| "js-date@8.0.0": | |
| 104, | |
| "js-fileio@2.1.0": | |
| 274, | |
| "js-fileio@2.2.0": | |
| 130, | |
| "js-fileio@3.0.0": | |
| 216, | |
| "js-history@2.0.1": | |
| -275, | |
| "js-history@2.0.2": | |
| -267, | |
| "js-history@2.0.3": | |
| -277, | |
| "js-promise@1.0.0": | |
| 69, | |
| "js-promise-aff@1.0.0": | |
| 108, | |
| "js-timers@1.0.0": | |
| 56, | |
| "js-timers@2.0.0": | |
| 124, | |
| "js-timers@3.0.0": | |
| 52, | |
| "js-timers@4.0.0": | |
| 50, | |
| "js-timers@4.0.1": | |
| 59, | |
| "js-timers@5.0.0": | |
| 76, | |
| "js-timers@5.0.1": | |
| 61, | |
| "js-timers@6.0.0": | |
| 73, | |
| "js-timers@6.1.0": | |
| 110, | |
| "js-uri@1.0.0": | |
| 45, | |
| "js-uri@2.0.0": | |
| 54, | |
| "js-uri@3.0.0": | |
| 71, | |
| "js-uri@3.1.0": | |
| 68, | |
| "jsdiff@0.1.0": | |
| 276, | |
| "json-minify@1.0.0": | |
| 49, | |
| "json-minify@1.0.1": | |
| 55, | |
| "json-minify@2.0.0": | |
| 51, | |
| "json-minify@3.0.0": | |
| 70, | |
| "json-pointer@0.1.0": | |
| 397, | |
| "json-pointer@1.0.0": | |
| 392, | |
| "json-pointer@1.1.0": | |
| 381, | |
| "json-schema@0.0.1": | |
| 280, | |
| "jsonrpc@0.1.0": | |
| 871, | |
| "jsonrpc@0.1.1": | |
| 836, | |
| "jsonrpc@0.2.0": | |
| 886, | |
| "jsonrpc@0.2.1": | |
| 863, | |
| "jtable@0.7.0": | |
| -178, | |
| "jtable@0.8.0": | |
| 305, | |
| "jtable@0.9.0": | |
| 184, | |
| "jtable@0.10.0": | |
| 184, | |
| "jtable@0.11.0": | |
| 133, | |
| "jtable@0.12.0": | |
| 141, | |
| "jtable@0.13.0": | |
| 141, | |
| "jtable@1.0.0": | |
| 103, | |
| "jtable@2.0.0": | |
| -359, | |
| "jtable@2.0.1": | |
| -242, | |
| "jtable@3.0.0": | |
| -549, | |
| "jtable@4.0.0": | |
| -420, | |
| "jtable@5.0.0": | |
| -847, | |
| "jtable@5.1.0": | |
| -938, | |
| "jtable@6.0.0": | |
| -826, | |
| "jtable@7.0.0": | |
| -807, | |
| "jtable@8.0.0": | |
| 760, | |
| "justifill@0.1.0": | |
| 416, | |
| "justifill@0.2.0": | |
| 16577, | |
| "justifill@0.2.1": | |
| 289, | |
| "justifill@0.3.1": | |
| 44, | |
| "justifill@0.5.0": | |
| 62, | |
| "jwt@0.0.1": | |
| 118, | |
| "jwt@0.0.2": | |
| -262, | |
| "jwt@0.0.3": | |
| 449, | |
| "jwt@0.0.4": | |
| 192, | |
| "jwt@0.0.5": | |
| 280, | |
| "jwt@0.0.6": | |
| 216, | |
| "jwt@0.0.7": | |
| 186, | |
| "jwt@0.0.8": | |
| -134, | |
| "jwt@0.0.9": | |
| 96, | |
| "kafkajs@0.1.0": | |
| 304, | |
| "kafkajs@0.2.0": | |
| -303, | |
| "kancho@0.1.0": | |
| 194, | |
| "kancho@0.2.0": | |
| 331, | |
| "kancho@0.3.0": | |
| 180, | |
| "kancho@1.0.0": | |
| 147, | |
| "kancho@2.0.0": | |
| 146, | |
| "kanren@1.0.0": | |
| 65, | |
| "kanren@2.0.0": | |
| 169, | |
| "karma-test-unit@1.0.0": | |
| -247, | |
| "karma-test-unit@1.0.1": | |
| 874, | |
| "karma-test-unit@1.0.2": | |
| 715, | |
| "karma-test-unit@1.1.0": | |
| 631, | |
| "karma-test-unit@2.0.0": | |
| 632, | |
| "karma-test-unit@3.0.0": | |
| 332, | |
| "kefir@0.1.0": | |
| 68, | |
| "kefir@0.2.0": | |
| 69, | |
| "kefir@0.3.0": | |
| 137, | |
| "kefir@0.4.0": | |
| 45, | |
| "kefir@0.5.0": | |
| 63, | |
| "kefir@0.6.0": | |
| 76, | |
| "kefir@0.6.1": | |
| 66, | |
| "kefir@0.6.2": | |
| 71, | |
| "kefir@0.6.3": | |
| 69, | |
| "kefir@0.6.4": | |
| 121, | |
| "kefir@0.6.5": | |
| 49, | |
| "kefir@0.6.6": | |
| 73, | |
| "kefir@0.6.7": | |
| 69, | |
| "kefir@0.6.8": | |
| 70, | |
| "kefir@0.6.9": | |
| 73, | |
| "key-based-diff@0.1.0": | |
| 327, | |
| "key-based-diff@0.1.1": | |
| 200, | |
| "key-based-diff@0.1.2": | |
| 206, | |
| "key-based-diff@0.2.0": | |
| 215, | |
| "key-based-diff@0.3.0": | |
| 205, | |
| "key-based-diff@0.4.0": | |
| 205, | |
| "kishimen@0.1.0": | |
| 111, | |
| "kishimen@0.2.0": | |
| 107, | |
| "kishimen@1.0.0": | |
| 225, | |
| "kishimen@1.0.1": | |
| 98, | |
| "kishimen@2.0.0": | |
| 102, | |
| "kleene-logic@0.1.0": | |
| 62, | |
| "knockoutjs@0.0.1": | |
| 84, | |
| "knockoutjs@0.0.2": | |
| 77, | |
| "kubernetes@0.1.0": | |
| 562, | |
| "kubernetes@0.1.1": | |
| 643, | |
| "kubernetes@0.1.2": | |
| 518, | |
| "kubernetes@0.2.0": | |
| 532, | |
| "kubernetes@0.3.0": | |
| 535, | |
| "kubernetes@0.4.0": | |
| 540, | |
| "kubernetes@0.5.0": | |
| 641, | |
| "kubernetes@0.6.0": | |
| 373, | |
| "kushiyaki@0.1.0": | |
| 167, | |
| "lambs@0.1.0": | |
| 311, | |
| "lambs@0.2.0": | |
| 319, | |
| "lambs@0.3.0": | |
| 316, | |
| "lambs@0.3.1": | |
| 315, | |
| "language-cst-parser@0.1.0": | |
| 162, | |
| "language-cst-parser@0.2.0": | |
| 247, | |
| "language-cst-parser@0.2.1": | |
| 153, | |
| "language-cst-parser@0.3.0": | |
| 163, | |
| "language-cst-parser@0.4.0": | |
| 160, | |
| "language-cst-parser@0.4.1": | |
| 161, | |
| "language-cst-parser@0.4.2": | |
| 159, | |
| "language-cst-parser@0.5.0": | |
| 259, | |
| "language-cst-parser@0.5.1": | |
| 142, | |
| "language-cst-parser@0.6.0": | |
| -174, | |
| "language-cst-parser@0.7.0": | |
| -175, | |
| "language-cst-parser@0.7.1": | |
| -183, | |
| "language-cst-parser@0.7.2": | |
| -185, | |
| "language-cst-parser@0.8.0": | |
| 190, | |
| "language-cst-parser@0.8.1": | |
| 109, | |
| "language-cst-parser@0.8.2": | |
| 102, | |
| "language-cst-parser@0.8.3": | |
| 118, | |
| "language-cst-parser@0.9.0": | |
| 112, | |
| "language-cst-parser@0.9.1": | |
| 114, | |
| "language-cst-parser@0.9.2": | |
| 112, | |
| "language-cst-parser@0.9.3": | |
| 113, | |
| "language-cst-parser@0.10.0": | |
| 198, | |
| "language-cst-parser@0.10.1": | |
| 112, | |
| "language-cst-parser@0.11.0": | |
| 110, | |
| "language-cst-parser@0.12.0": | |
| 95, | |
| "language-cst-parser@0.12.1": | |
| 100, | |
| "language-purescript-ast@0.0.1": | |
| 98, | |
| "language-purescript-base@0.0.1": | |
| 89, | |
| "language-purescript-base@0.0.2": | |
| 88, | |
| "language-purescript-base@0.0.3": | |
| 175, | |
| "lattice@0.1.0": | |
| 59, | |
| "lattice@0.2.0": | |
| 56, | |
| "lattice@0.3.0": | |
| 76, | |
| "lazy@0.1.1": | |
| -66, | |
| "lazy@0.1.2": | |
| 74, | |
| "lazy@0.2.0": | |
| 73, | |
| "lazy@0.3.0": | |
| 70, | |
| "lazy@0.3.1": | |
| 120, | |
| "lazy@0.4.0": | |
| 97, | |
| "lazy@0.4.1": | |
| 48, | |
| "lazy@1.0.0": | |
| 71, | |
| "lazy@1.0.1": | |
| 66, | |
| "lazy@2.0.0": | |
| 67, | |
| "lazy@3.0.0": | |
| 68, | |
| "lazy@4.0.0": | |
| 74, | |
| "lazy@5.0.0": | |
| 105, | |
| "lazy@6.0.0": | |
| 119, | |
| "lazy-joe@1.0.0": | |
| 108, | |
| "lcg@1.0.0": | |
| 71, | |
| "lcg@2.0.0": | |
| 67, | |
| "lcg@3.0.0": | |
| 71, | |
| "lcg@4.0.0": | |
| 74, | |
| "leaflet@0.1.0": | |
| 62, | |
| "leaflet-tdammers@0.0.1": | |
| 77, | |
| "leaflet-tdammers@0.0.3": | |
| 146, | |
| "leaflet-tdammers@0.0.4": | |
| 111, | |
| "leaflet-tdammers@0.1.0": | |
| 148, | |
| "leaflet-tdammers@0.2.0": | |
| 134, | |
| "leaflet-tdammers@0.3.0": | |
| 133, | |
| "leafletjs@0.1.0": | |
| 773, | |
| "leafletjs@0.2.0": | |
| 770, | |
| "leafletjs@0.3.0": | |
| 1035, | |
| "leafletjs@0.3.1": | |
| 895, | |
| "leafletjs@4.0.0": | |
| 925, | |
| "leafletjs@5.0.0": | |
| 909, | |
| "leafletjs@5.1.0": | |
| 920, | |
| "leafletjs@6.0.0": | |
| 950, | |
| "leafletjs-halogen@0.1.0": | |
| 1590, | |
| "leafletjs-halogen@0.2.0": | |
| 1717, | |
| "leafletjs-halogen@1.0.0": | |
| 1249, | |
| "leafletjs-halogen@2.0.0": | |
| 1233, | |
| "leafletjs-halogen@3.0.0": | |
| 1332, | |
| "learn@0.1.0": | |
| -105, | |
| "learn@0.2.0": | |
| 114, | |
| "learn@0.3.0": | |
| 228, | |
| "leibniz@1.0.0": | |
| 56, | |
| "leibniz@1.1.0": | |
| 74, | |
| "leibniz@2.0.0": | |
| 66, | |
| "leibniz@3.0.0": | |
| 74, | |
| "leibniz@4.0.0": | |
| 128, | |
| "leibniz@4.1.0": | |
| 50, | |
| "leibniz@5.0.0": | |
| 61, | |
| "lenient-html-parser@0.1.0": | |
| 218, | |
| "lenient-html-parser@0.2.0": | |
| 375, | |
| "lenient-html-parser@0.3.0": | |
| 361, | |
| "lenient-html-parser@0.3.1": | |
| 337, | |
| "lenient-html-parser@0.3.2": | |
| 471, | |
| "lenient-html-parser@1.0.0": | |
| 322, | |
| "lenient-html-parser@2.0.0": | |
| 202, | |
| "lenient-html-parser@3.0.0": | |
| 162, | |
| "lenient-html-parser@3.0.1": | |
| 159, | |
| "lenient-html-parser@4.0.0": | |
| 163, | |
| "lens@0.0.1": | |
| -70, | |
| "lens@0.0.2": | |
| -115, | |
| "lens@0.0.3": | |
| -110, | |
| "lens@0.1.0": | |
| -59, | |
| "lens@0.1.1": | |
| -74, | |
| "lens@0.1.2": | |
| -69, | |
| "lens@0.1.3": | |
| -82, | |
| "lens@0.2.0": | |
| -74, | |
| "lens@0.2.1": | |
| -76, | |
| "lens@0.2.2": | |
| -70, | |
| "lens@0.2.3": | |
| -151, | |
| "lens@0.3.0": | |
| -77, | |
| "lens@0.3.1": | |
| -69, | |
| "lens@0.3.2": | |
| -82, | |
| "lens@0.3.3": | |
| -77, | |
| "lens@0.5.0": | |
| 75, | |
| "lens@0.6.0": | |
| 148, | |
| "lens@0.7.0": | |
| 87, | |
| "lens@0.8.0": | |
| 54, | |
| "lens@0.9.0": | |
| 82, | |
| "lens@0.9.1": | |
| 76, | |
| "lens@0.10.0": | |
| 69, | |
| "lens@0.10.1": | |
| 65, | |
| "lens@1.0.0": | |
| 74, | |
| "lens@2.0.0": | |
| -161, | |
| "lens@3.0.0": | |
| 104, | |
| "lens@4.0.0": | |
| 58, | |
| "lens@5.0.0": | |
| 85, | |
| "lens@5.0.1": | |
| 77, | |
| "lens-simple@1.0.1": | |
| 64, | |
| "lens-simple@2.0.0": | |
| 78, | |
| "lens-simple@3.0.0": | |
| 95, | |
| "lens-simple@4.0.0": | |
| 103, | |
| "linalg@1.0.0": | |
| 130, | |
| "linalg@1.1.0": | |
| 58, | |
| "linalg@4.0.0": | |
| 84, | |
| "linalg@5.0.0": | |
| 81, | |
| "linalg@5.1.0": | |
| 80, | |
| "line-reader@0.1.0": | |
| 790, | |
| "line-reader@0.1.1": | |
| 774, | |
| "line-reader@0.1.2": | |
| 882, | |
| "line-reader@0.2.0": | |
| 749, | |
| "line-wrapping@1.0.0": | |
| 75, | |
| "line-wrapping@1.1.0": | |
| 82, | |
| "line-wrapping@2.0.0": | |
| 152, | |
| "linear-algebra@0.1.0": | |
| 106, | |
| "linear-algebra@0.1.1": | |
| 110, | |
| "linear-algebra@0.2.0": | |
| 109, | |
| "linear-algebra@0.3.0": | |
| 199, | |
| "linear-algebra@0.4.0": | |
| 101, | |
| "linear-algebra@0.5.0": | |
| 94, | |
| "list-zipper@0.1.0": | |
| 70, | |
| "lists@0.3.4": | |
| -83, | |
| "lists@0.3.5": | |
| -82, | |
| "lists@0.3.7": | |
| -123, | |
| "lists@0.3.8": | |
| -95, | |
| "lists@0.3.9": | |
| -55, | |
| "lists@0.4.0": | |
| -82, | |
| "lists@0.5.0": | |
| -72, | |
| "lists@0.6.0": | |
| 80, | |
| "lists@0.6.1": | |
| 85, | |
| "lists@0.6.2": | |
| 79, | |
| "lists@0.7.0": | |
| 78, | |
| "lists@0.7.1": | |
| 141, | |
| "lists@0.7.2": | |
| 71, | |
| "lists@0.7.3": | |
| 73, | |
| "lists@0.7.4": | |
| 78, | |
| "lists@0.7.5": | |
| 75, | |
| "lists@0.7.6": | |
| 77, | |
| "lists@0.7.7": | |
| 131, | |
| "lists@0.7.8": | |
| 61, | |
| "lists@0.7.9": | |
| 86, | |
| "lists@0.7.10": | |
| 78, | |
| "lists@1.0.0": | |
| 68, | |
| "lists@1.0.1": | |
| 75, | |
| "lists@2.0.0": | |
| 100, | |
| "lists@2.1.0": | |
| 171, | |
| "lists@3.0.0": | |
| 91, | |
| "lists@3.0.1": | |
| 111, | |
| "lists@3.1.0": | |
| 113, | |
| "lists@3.2.0": | |
| 118, | |
| "lists@3.2.1": | |
| 120, | |
| "lists@3.2.2": | |
| 190, | |
| "lists@3.3.0": | |
| 105, | |
| "lists@3.4.0": | |
| 99, | |
| "lists@4.0.0": | |
| 95, | |
| "lists@4.0.1": | |
| 152, | |
| "lists@4.1.0": | |
| 96, | |
| "lists@4.1.1": | |
| 93, | |
| "lists@4.2.0": | |
| 97, | |
| "lists@4.3.0": | |
| 169, | |
| "lists@4.4.0": | |
| 86, | |
| "lists@4.5.0": | |
| 82, | |
| "lists@4.6.0": | |
| 93, | |
| "lists@4.6.1": | |
| 94, | |
| "lists@4.7.0": | |
| 93, | |
| "lists@4.8.0": | |
| 97, | |
| "lists@4.9.0": | |
| 152, | |
| "lists@4.9.1": | |
| 156, | |
| "lists@4.10.0": | |
| 85, | |
| "lists@4.11.0": | |
| 72, | |
| "lists@4.12.0": | |
| 88, | |
| "lists@5.0.0": | |
| 82, | |
| "lists@5.1.0": | |
| 85, | |
| "lists@5.2.0": | |
| 87, | |
| "lists@5.3.0": | |
| 87, | |
| "lists@5.4.0": | |
| 158, | |
| "lists@5.4.1": | |
| 72, | |
| "lists@6.0.0": | |
| 69, | |
| "lists@6.0.1": | |
| 90, | |
| "lists@6.1.0": | |
| 82, | |
| "lists@7.0.0": | |
| 81, | |
| "lists-fast@1.0.0": | |
| 103, | |
| "lists-fast@1.0.1": | |
| 101, | |
| "lit-html@0.1.0": | |
| 437, | |
| "lit-html@0.2.0": | |
| 330, | |
| "literals@0.1.0": | |
| 51, | |
| "literals@0.1.1": | |
| 77, | |
| "literals@0.2.0": | |
| 68, | |
| "literals@1.0.0": | |
| 71, | |
| "literals@1.0.1": | |
| 68, | |
| "literals@1.0.2": | |
| 68, | |
| "lnforum-types@0.11.0": | |
| -1063, | |
| "localstorage@0.1.0": | |
| 89, | |
| "localstorage@0.1.1": | |
| 106, | |
| "localstorage@0.1.2": | |
| 115, | |
| "localstorage@0.1.3": | |
| 108, | |
| "localstorage@1.0.0": | |
| 80, | |
| "localstorage@2.0.0": | |
| -206, | |
| "localstorage@3.0.1": | |
| -347, | |
| "localstorage@4.0.0": | |
| 593, | |
| "location@1.0.0": | |
| 44, | |
| "logging@0.0.1": | |
| 75, | |
| "logging@0.0.2": | |
| 75, | |
| "logging@0.0.3": | |
| 76, | |
| "logging@0.1.0": | |
| 78, | |
| "logging@1.0.0": | |
| 226, | |
| "logging@1.1.0": | |
| 98, | |
| "logging@2.0.0": | |
| 95, | |
| "logging@3.0.0": | |
| 97, | |
| "logging-bunyan@1.0.0": | |
| 78, | |
| "logging-bunyan@2.0.0": | |
| 248, | |
| "logging-bunyan@3.0.0": | |
| 356, | |
| "logging-journald@0.0.1": | |
| 358, | |
| "logging-journald@0.1.0": | |
| 494, | |
| "logging-journald@0.2.1": | |
| 114, | |
| "logging-journald@0.2.2": | |
| 118, | |
| "logging-journald@0.2.3": | |
| 187, | |
| "logging-journald@0.2.4": | |
| 181, | |
| "logging-journald@0.2.5": | |
| 115, | |
| "logging-journald@0.3.0": | |
| 117, | |
| "logging-journald@0.3.1": | |
| 191, | |
| "logging-journald@0.3.2": | |
| 105, | |
| "logging-journald@0.4.0": | |
| -73, | |
| "logic@0.0.3": | |
| 121, | |
| "logic@0.0.4": | |
| 120, | |
| "logic@0.0.5": | |
| 121, | |
| "logic@0.1.0": | |
| 124, | |
| "logoot-core@0.0.2": | |
| 197, | |
| "longs@0.1.0": | |
| 227, | |
| "longs@0.1.1": | |
| 134, | |
| "lowdb@0.1.1": | |
| -79, | |
| "luhncheck@0.0.1": | |
| 122, | |
| "luhncheck@0.0.2": | |
| 118, | |
| "luhncheck@0.0.3": | |
| 129, | |
| "luhncheck@0.0.4": | |
| 130, | |
| "luhncheck@0.0.5": | |
| 134, | |
| "luhncheck@0.0.6": | |
| 203, | |
| "lunapark@5.0.0": | |
| 421, | |
| "lunapark@5.0.1": | |
| 404, | |
| "lunapark@5.0.2": | |
| 414, | |
| "lunapark@6.0.0": | |
| 381, | |
| "lunapark@6.1.0": | |
| 385, | |
| "lunapark@6.2.0": | |
| 394, | |
| "lunapark@7.0.0": | |
| 370, | |
| "lunar-calendar@0.1.0": | |
| 95, | |
| "machines@0.1.0": | |
| -46, | |
| "machines@0.1.1": | |
| -78, | |
| "machines@0.1.2": | |
| -64, | |
| "machines@0.1.3": | |
| -70, | |
| "machines@0.1.4": | |
| -75, | |
| "machines@0.1.5": | |
| -69, | |
| "machines@0.1.6": | |
| -117, | |
| "machines@0.1.7": | |
| -97, | |
| "machines@0.2.0": | |
| -47, | |
| "machines@0.3.0": | |
| -76, | |
| "machines@0.4.0": | |
| 72, | |
| "machines@0.5.0": | |
| 74, | |
| "machines@0.6.0": | |
| 62, | |
| "machines@0.6.1": | |
| 79, | |
| "machines@0.7.0": | |
| 149, | |
| "machines@0.8.0": | |
| 98, | |
| "machines@0.8.1": | |
| 54, | |
| "machines@1.0.0": | |
| 76, | |
| "machines@2.0.0": | |
| 153, | |
| "machines@2.0.1": | |
| 138, | |
| "machines@3.0.0": | |
| 148, | |
| "machines@4.0.0": | |
| 215, | |
| "machines@5.0.0": | |
| 180, | |
| "machines@5.1.0": | |
| 93, | |
| "machines@6.0.0": | |
| 72, | |
| "machines@6.1.0": | |
| 86, | |
| "machines@7.0.0": | |
| 78, | |
| "makkori@0.1.0": | |
| 641, | |
| "makkori@1.0.0": | |
| 286, | |
| "maps@0.2.0": | |
| 67, | |
| "maps@0.3.0": | |
| 161, | |
| "maps@0.3.1": | |
| 95, | |
| "maps@0.3.2": | |
| 61, | |
| "maps@0.3.3": | |
| 78, | |
| "maps@0.3.4": | |
| 71, | |
| "maps@0.4.0": | |
| 78, | |
| "maps@0.4.1": | |
| 82, | |
| "maps@0.4.2": | |
| 77, | |
| "maps@0.5.0": | |
| 176, | |
| "maps@0.5.1": | |
| 84, | |
| "maps@0.5.2": | |
| 70, | |
| "maps@0.5.3": | |
| 80, | |
| "maps@0.5.4": | |
| 79, | |
| "maps@0.5.5": | |
| 75, | |
| "maps@0.5.6": | |
| 76, | |
| "maps@0.5.7": | |
| 84, | |
| "maps@1.0.0": | |
| 141, | |
| "maps@1.1.0": | |
| 74, | |
| "maps@1.2.0": | |
| 75, | |
| "maps@2.0.0": | |
| 171, | |
| "maps@2.0.1": | |
| 152, | |
| "maps@2.0.2": | |
| 138, | |
| "maps@2.1.0": | |
| 236, | |
| "maps@2.1.1": | |
| 120, | |
| "maps@2.1.2": | |
| 134, | |
| "maps@3.0.0": | |
| 182, | |
| "maps@3.0.1": | |
| 207, | |
| "maps@3.1.0": | |
| 205, | |
| "maps@3.2.0": | |
| 198, | |
| "maps@3.3.0": | |
| 195, | |
| "maps@3.3.1": | |
| 327, | |
| "maps@3.4.0": | |
| 363, | |
| "maps@3.5.0": | |
| 185, | |
| "maps@3.5.1": | |
| 165, | |
| "maps@3.5.2": | |
| 166, | |
| "maps@3.6.0": | |
| 164, | |
| "maps@3.6.1": | |
| 170, | |
| "maps-eager@0.2.0": | |
| 137, | |
| "maps-eager@0.3.0": | |
| 198, | |
| "maps-eager@0.3.1": | |
| 81, | |
| "markdown@0.12.0": | |
| 96, | |
| "markdown@1.0.0": | |
| 73, | |
| "markdown@1.1.0": | |
| 96, | |
| "markdown@1.5.0": | |
| 74, | |
| "markdown@1.5.1": | |
| 82, | |
| "markdown@1.5.2": | |
| 141, | |
| "markdown@1.6.0": | |
| 59, | |
| "markdown@1.7.0": | |
| 108, | |
| "markdown@1.7.1": | |
| 95, | |
| "markdown@1.8.0": | |
| 94, | |
| "markdown@1.9.0": | |
| 165, | |
| "markdown@1.9.1": | |
| 90, | |
| "markdown@1.10.0": | |
| 78, | |
| "markdown@1.11.0": | |
| 97, | |
| "markdown@1.11.1": | |
| 99, | |
| "markdown@1.12.0": | |
| 95, | |
| "markdown@1.12.1": | |
| 100, | |
| "markdown@1.12.2": | |
| 99, | |
| "markdown@2.0.0": | |
| 183, | |
| "markdown@2.0.1": | |
| 102, | |
| "markdown@3.0.0": | |
| -84, | |
| "markdown@3.1.0": | |
| -101, | |
| "markdown@3.1.1": | |
| -97, | |
| "markdown@3.1.2": | |
| -102, | |
| "markdown@4.0.0": | |
| -104, | |
| "markdown@5.0.0": | |
| -108, | |
| "markdown@7.0.0": | |
| 166, | |
| "markdown@8.0.0": | |
| 447, | |
| "markdown@8.0.1": | |
| 418, | |
| "markdown@9.0.0": | |
| -276, | |
| "markdown@10.0.0": | |
| 603, | |
| "markdown@11.0.0": | |
| 609, | |
| "markdown@11.0.1": | |
| 605, | |
| "markdown@12.0.0": | |
| 362, | |
| "markdown-halogen@0.7.0": | |
| 292, | |
| "markdown-halogen@0.8.0": | |
| 250, | |
| "markdown-halogen@0.8.1": | |
| 212, | |
| "markdown-halogen@0.8.2": | |
| 216, | |
| "markdown-halogen@0.8.3": | |
| 214, | |
| "markdown-halogen@0.8.4": | |
| 213, | |
| "markdown-halogen@0.8.5": | |
| 219, | |
| "markdown-halogen@0.9.0": | |
| 273, | |
| "markdown-halogen@0.10.0": | |
| -149, | |
| "markdown-halogen@0.11.0": | |
| -146, | |
| "markdown-halogen@0.12.0": | |
| -149, | |
| "markdown-halogen@0.13.0": | |
| -152, | |
| "markdown-halogen@0.14.0": | |
| -149, | |
| "markdown-halogen@0.15.0": | |
| -239, | |
| "markdown-halogen@1.0.0": | |
| -100, | |
| "markdown-halogen@2.0.0": | |
| -213, | |
| "markdown-halogen@3.0.0": | |
| -768, | |
| "markdown-halogen@3.0.1": | |
| -777, | |
| "markdown-halogen@4.0.0": | |
| -820, | |
| "markdown-halogen@5.0.0": | |
| -685, | |
| "markdown-halogen@5.0.1": | |
| -820, | |
| "markdown-halogen@6.0.0": | |
| 1424, | |
| "markdown-halogen@7.0.0": | |
| 1094, | |
| "markdown-halogen@8.0.0": | |
| 1511, | |
| "markdown-halogen@8.0.1": | |
| 1654, | |
| "markdown-halogen@9.0.0": | |
| 1313, | |
| "markdown-halogen@9.0.1": | |
| 1331, | |
| "markdown-it@0.1.0": | |
| 214, | |
| "markdown-it@0.2.0": | |
| 215, | |
| "markdown-it@0.3.0": | |
| 219, | |
| "markdown-it@0.4.0": | |
| 347, | |
| "markdown-it@0.5.0": | |
| 4830, | |
| "markdown-smolder@1.0.0": | |
| -495, | |
| "markdown-smolder@1.1.0": | |
| -488, | |
| "markdown-smolder@1.2.0": | |
| -490, | |
| "markdown-smolder@1.3.0": | |
| -493, | |
| "mason-prelude@0.3.0": | |
| 126, | |
| "mason-prelude@0.4.0": | |
| 228, | |
| "mason-prelude@0.5.0": | |
| 135, | |
| "mason-prelude@0.6.0": | |
| -97, | |
| "mason-prelude@0.7.0": | |
| -104, | |
| "mason-prelude@0.7.1": | |
| -99, | |
| "mason-prelude@0.8.0": | |
| -98, | |
| "mason-prelude@0.8.1": | |
| -184, | |
| "mason-prelude@0.9.0": | |
| -94, | |
| "mason-prelude@0.9.1": | |
| -82, | |
| "mason-prelude@0.10.0": | |
| -92, | |
| "materialize@0.1.3": | |
| 369, | |
| "materialize@0.1.4": | |
| 365, | |
| "materialize@0.1.5": | |
| 367, | |
| "materialize@0.1.6": | |
| 361, | |
| "math@0.1.0": | |
| 130, | |
| "math@0.1.1": | |
| 48, | |
| "math@0.2.0": | |
| 57, | |
| "math@1.0.0": | |
| 64, | |
| "math@2.0.0": | |
| 65, | |
| "math@2.1.0": | |
| 67, | |
| "math@2.1.1": | |
| 70, | |
| "math@3.0.0": | |
| 95, | |
| "math-equation@0.0.0": | |
| -453, | |
| "math-equation@0.0.1": | |
| -435, | |
| "mathbox@0.1.0": | |
| -460, | |
| "mathbox@0.1.1": | |
| -381, | |
| "mathbox@0.1.2": | |
| -382, | |
| "mathbox@0.2.0": | |
| -391, | |
| "mathbox@0.3.0": | |
| 483, | |
| "mathbox@0.4.0": | |
| 673, | |
| "mathbox@0.5.0": | |
| 190, | |
| "mathbox@0.6.0": | |
| 205, | |
| "matrices@1.0.0": | |
| 64, | |
| "matrices@1.0.1": | |
| 69, | |
| "matrices@2.0.0": | |
| 99, | |
| "matrices@3.0.0": | |
| 325, | |
| "matrices@4.0.0": | |
| 112, | |
| "matrices@5.0.0": | |
| 109, | |
| "matrices@5.0.1": | |
| 122, | |
| "matrix@1.0.0": | |
| 280, | |
| "matrix@1.0.1": | |
| 277, | |
| "matrix@1.0.2": | |
| 281, | |
| "matrix@1.1.0": | |
| 376, | |
| "matrix@1.2.0": | |
| 233, | |
| "matrix@2.0.0": | |
| 443, | |
| "matrix@2.1.0": | |
| 350, | |
| "matryoshka@0.1.0": | |
| -190, | |
| "matryoshka@0.1.1": | |
| -193, | |
| "matryoshka@0.2.0": | |
| -192, | |
| "matryoshka@0.3.0": | |
| 354, | |
| "matryoshka@0.4.0": | |
| 231, | |
| "matryoshka@0.5.0": | |
| 89, | |
| "matryoshka@1.0.0": | |
| 71, | |
| "maybe@0.1.0": | |
| 54, | |
| "maybe@0.1.1": | |
| 71, | |
| "maybe@0.1.2": | |
| 66, | |
| "maybe@0.1.3": | |
| 66, | |
| "maybe@0.2.0": | |
| 124, | |
| "maybe@0.2.1": | |
| 54, | |
| "maybe@0.2.2": | |
| 53, | |
| "maybe@0.3.0": | |
| 76, | |
| "maybe@0.3.1": | |
| 62, | |
| "maybe@0.3.2": | |
| 75, | |
| "maybe@0.3.3": | |
| 70, | |
| "maybe@0.3.4": | |
| 70, | |
| "maybe@0.3.5": | |
| 146, | |
| "maybe@1.0.0": | |
| 49, | |
| "maybe@2.0.0": | |
| 79, | |
| "maybe@2.0.1": | |
| 67, | |
| "maybe@2.1.0": | |
| 71, | |
| "maybe@2.1.1": | |
| 69, | |
| "maybe@3.0.0": | |
| 74, | |
| "maybe@3.1.0": | |
| 76, | |
| "maybe@4.0.0": | |
| 81, | |
| "maybe@4.0.1": | |
| 141, | |
| "maybe@5.0.0": | |
| 56, | |
| "maybe@6.0.0": | |
| 75, | |
| "mdast-util-from-markdown@0.1.5": | |
| 273, | |
| "mdast-util-from-markdown@0.2.0": | |
| 393, | |
| "mdast-util-from-markdown@0.2.1": | |
| 360, | |
| "media-types@0.1.0": | |
| 50, | |
| "media-types@0.1.1": | |
| 53, | |
| "media-types@1.0.0": | |
| 78, | |
| "media-types@2.0.0": | |
| 124, | |
| "media-types@3.0.0": | |
| 206, | |
| "media-types@4.0.0": | |
| 57, | |
| "media-types@4.0.1": | |
| 74, | |
| "media-types@5.0.0": | |
| 131, | |
| "media-types@6.0.0": | |
| 66, | |
| "memoize@2.0.1": | |
| 74, | |
| "memoize@3.0.0": | |
| 195, | |
| "memoize@4.0.0": | |
| 163, | |
| "memoize@4.0.1": | |
| 234, | |
| "memoize@5.0.0": | |
| 127, | |
| "merkle-tree@0.0.1": | |
| 94, | |
| "merkle-tree@0.0.2": | |
| 197, | |
| "merkle-tree@0.0.3": | |
| 85, | |
| "merkle-tree@0.0.4": | |
| 97, | |
| "mersenne@0.0.1": | |
| 77, | |
| "mersenne@0.0.2": | |
| 85, | |
| "mersenne@1.0.0": | |
| 106, | |
| "mesos@0.0.0": | |
| -285, | |
| "metajelo@1.0.0": | |
| 453, | |
| "metajelo@1.0.1": | |
| 328, | |
| "metajelo@1.1.0": | |
| 311, | |
| "metajelo@2.0.0": | |
| 308, | |
| "metajelo@3.0.0": | |
| 315, | |
| "metajelo@3.0.1": | |
| 430, | |
| "metajelo@3.1.0": | |
| 298, | |
| "metajelo-ui-css-classes@0.0.1": | |
| -403, | |
| "metajelo-ui-css-classes@0.0.2": | |
| -413, | |
| "metajelo-ui-css-classes@0.0.3": | |
| -423, | |
| "metajelo-ui-css-classes@0.1.0": | |
| -426, | |
| "metajelo-ui-css-classes@0.1.1": | |
| -414, | |
| "metajelo-ui-css-classes@0.1.2": | |
| -535, | |
| "metajelo-ui-css-classes@0.1.3": | |
| -405, | |
| "metajelo-ui-css-classes@0.1.6": | |
| -414, | |
| "metajelo-ui-css-classes@1.0.0": | |
| -420, | |
| "metajelo-ui-css-classes@1.0.1": | |
| -413, | |
| "metajelo-web@1.0.2": | |
| -315, | |
| "metajelo-web@2.0.0": | |
| -399, | |
| "metric@1.0.0": | |
| 51, | |
| "metric@2.0.0": | |
| 49, | |
| "metric@2.1.0": | |
| 70, | |
| "metrics@1.0.0": | |
| 433, | |
| "midi@1.2.0": | |
| 451, | |
| "midi@2.0.0": | |
| 231, | |
| "midi@2.1.0": | |
| 241, | |
| "midi@2.2.0": | |
| 348, | |
| "midi@2.2.1": | |
| 207, | |
| "midi@2.3.0": | |
| 212, | |
| "midi@2.3.1": | |
| 222, | |
| "midi@2.3.2": | |
| 218, | |
| "midi@2.3.3": | |
| -214, | |
| "midi@3.0.0": | |
| 238, | |
| "midi@3.1.0": | |
| 194, | |
| "midi@4.0.0": | |
| 96, | |
| "milkis@0.1.0": | |
| 404, | |
| "milkis@0.1.1": | |
| 388, | |
| "milkis@0.2.0": | |
| 388, | |
| "milkis@1.0.0": | |
| 494, | |
| "milkis@2.0.0": | |
| 387, | |
| "milkis@3.0.0": | |
| 700, | |
| "milkis@4.0.0": | |
| 697, | |
| "milkis@4.0.1": | |
| 700, | |
| "milkis@5.0.0": | |
| 558, | |
| "milkis@5.0.1": | |
| 647, | |
| "milkis@5.0.2": | |
| 684, | |
| "milkis@6.0.0": | |
| 241, | |
| "milkis@6.0.1": | |
| 236, | |
| "milkis@6.1.0": | |
| 255, | |
| "milkis@6.2.0": | |
| 370, | |
| "milkis@6.3.0": | |
| 230, | |
| "milkis@6.3.1": | |
| 241, | |
| "milkis@7.0.0": | |
| 243, | |
| "milkis@7.0.1": | |
| 241, | |
| "milkis@7.1.0": | |
| 244, | |
| "milkis@7.2.0": | |
| 243, | |
| "milkis@7.2.1": | |
| 338, | |
| "milkis@7.4.0": | |
| 236, | |
| "milkis@7.5.0": | |
| 10551, | |
| "milkis@8.0.0": | |
| 135, | |
| "milkis@9.0.0": | |
| 217, | |
| "mime@0.0.1": | |
| 47, | |
| "mime@0.0.2": | |
| 57, | |
| "mini-redux@1.0.0": | |
| 75, | |
| "mini-redux@1.0.1": | |
| 68, | |
| "mini-redux@1.0.2": | |
| 69, | |
| "mini-redux@1.1.0": | |
| 76, | |
| "mini-redux@2.0.0": | |
| 136, | |
| "mini-redux@2.1.0": | |
| 97, | |
| "mini-redux@2.1.1": | |
| 68, | |
| "mini-redux@2.1.2": | |
| 74, | |
| "mini-redux@3.0.0": | |
| 70, | |
| "mini-redux@3.0.1": | |
| 77, | |
| "mini-redux@3.0.2": | |
| 70, | |
| "minibench@1.0.0": | |
| 79, | |
| "minibench@1.0.1": | |
| 136, | |
| "minibench@2.0.0": | |
| 58, | |
| "minibench@3.0.0": | |
| 70, | |
| "minibench@4.0.0": | |
| 67, | |
| "minibench@4.0.1": | |
| 89, | |
| "minimatch@0.1.0": | |
| 58, | |
| "minimatch@0.2.0": | |
| 111, | |
| "minimist@0.0.1": | |
| 262, | |
| "minimist@0.0.2": | |
| 229, | |
| "minimist@0.1.0": | |
| 240, | |
| "minimist@0.2.0": | |
| 236, | |
| "minimist@0.3.0": | |
| 324, | |
| "minimist@0.3.1": | |
| 229, | |
| "minimist@0.4.0": | |
| 311, | |
| "mkdirp@0.1.0": | |
| -190, | |
| "mkdirp@0.2.0": | |
| 311, | |
| "mkdirp@0.3.0": | |
| 503, | |
| "mmorph@1.0.0": | |
| -74, | |
| "mmorph@2.0.0": | |
| 73, | |
| "mmorph@3.0.0": | |
| 237, | |
| "mmorph@5.0.0": | |
| 97, | |
| "mmorph@5.1.0": | |
| 117, | |
| "mmorph@6.0.0": | |
| 96, | |
| "mmorph@7.0.0": | |
| 81, | |
| "mocha@0.0.2": | |
| 59, | |
| "mocha@0.0.3": | |
| 71, | |
| "mocha@0.0.4": | |
| 137, | |
| "mocha@0.0.5": | |
| 48, | |
| "mochi@0.1.0": | |
| 141, | |
| "mockfree@0.1.0": | |
| 79, | |
| "modular-arithmetic@1.0.0": | |
| 172, | |
| "modular-arithmetic@1.0.1": | |
| 160, | |
| "modular-arithmetic@2.0.0": | |
| 298, | |
| "modular-arithmetic@3.0.0": | |
| 384, | |
| "modular-arithmetic@3.1.0": | |
| 254, | |
| "modular-arithmetic@4.0.0": | |
| 95, | |
| "modules@2.1.0": | |
| 58, | |
| "modules@2.2.0": | |
| 70, | |
| "modules@3.0.0": | |
| 147, | |
| "mol-draw@1.0.1": | |
| 158, | |
| "mol-draw@1.0.6": | |
| 115, | |
| "mol-draw@1.0.7": | |
| 126, | |
| "mol-draw@1.0.8": | |
| 135, | |
| "mol-draw@1.0.9": | |
| 129, | |
| "mol-draw@1.0.10": | |
| 140, | |
| "mol-draw@1.0.11": | |
| 137, | |
| "mol-draw@1.0.12": | |
| 255, | |
| "mol-draw@1.0.13": | |
| 115, | |
| "mol-draw@1.0.14": | |
| 116, | |
| "mol-draw@1.0.15": | |
| 129, | |
| "mol-draw@1.0.16": | |
| 128, | |
| "moldy@0.1.0": | |
| 69, | |
| "moldy@1.0.0": | |
| 75, | |
| "moldy@2.0.0": | |
| 210, | |
| "moldy@2.1.0": | |
| 223, | |
| "moldy@3.0.0": | |
| 109, | |
| "moment@0.0.2": | |
| 70, | |
| "monad-control@3.0.0": | |
| 228, | |
| "monad-control@3.0.1": | |
| 204, | |
| "monad-control@3.0.2": | |
| 203, | |
| "monad-control@4.0.0": | |
| 420, | |
| "monad-control@4.1.0": | |
| 287, | |
| "monad-control@5.0.0": | |
| 210, | |
| "monad-eff@0.1.0": | |
| 74, | |
| "monad-logger@1.0.0": | |
| 412, | |
| "monad-logger@1.1.0": | |
| 366, | |
| "monad-logger@1.2.0": | |
| 368, | |
| "monad-logger@1.3.0": | |
| 458, | |
| "monad-logger@1.3.1": | |
| 357, | |
| "monad-logger-writer@0.0.1": | |
| 48, | |
| "monad-logger-writer@0.0.2": | |
| 73, | |
| "monad-logger-writer@0.0.3": | |
| 71, | |
| "monad-loops@0.1.0": | |
| 57, | |
| "monad-loops@0.2.0": | |
| 90, | |
| "monad-loops@0.2.1": | |
| 73, | |
| "monad-loops@0.3.0": | |
| 167, | |
| "monad-loops@0.3.1": | |
| 151, | |
| "monad-loops@0.3.2": | |
| 114, | |
| "monad-loops@0.3.3": | |
| 128, | |
| "monad-loops@0.3.4": | |
| 125, | |
| "monad-loops@0.3.5": | |
| 129, | |
| "monad-loops@0.4.0": | |
| 183, | |
| "monad-loops@0.5.0": | |
| 101, | |
| "monad-supply@0.0.1": | |
| 155, | |
| "monad-unlift@0.0.0": | |
| 471, | |
| "monad-unlift@1.0.0": | |
| 335, | |
| "monad-unlift@1.0.1": | |
| 379, | |
| "monadic-streams@0.0.1": | |
| 65, | |
| "monadplus-partial@0.1.0": | |
| 71, | |
| "monadplus-partial@0.1.1": | |
| 125, | |
| "monadplus-partial@0.2.0": | |
| 49, | |
| "monadplus-partial@0.2.1": | |
| 74, | |
| "monadplus-partial@0.2.2": | |
| 65, | |
| "monadplus-partial@1.0.0": | |
| 67, | |
| "money@4.1.0": | |
| 98, | |
| "money@4.2.0": | |
| 160, | |
| "money@4.3.0": | |
| 81, | |
| "money@5.0.0": | |
| 135, | |
| "money@6.0.0": | |
| 119, | |
| "money@7.0.0": | |
| 223, | |
| "mongodbf@0.0.4": | |
| -64, | |
| "mongodbf@0.0.5": | |
| -137, | |
| "mongodbf@0.1.0": | |
| 56, | |
| "mongodbf@0.2.0": | |
| 87, | |
| "monoid@0.1.5": | |
| 61, | |
| "monoid@0.2.0": | |
| 76, | |
| "monoid@0.3.0": | |
| 57, | |
| "monoid@0.3.1": | |
| 109, | |
| "monoid@0.3.2": | |
| 44, | |
| "monoid@1.0.0": | |
| 59, | |
| "monoid@2.0.0": | |
| 66, | |
| "monoid@2.1.0": | |
| 69, | |
| "monoid@2.2.0": | |
| 70, | |
| "monoid@3.0.0": | |
| 114, | |
| "monoid@3.1.0": | |
| 48, | |
| "monoid@3.2.0": | |
| 57, | |
| "monoid@3.3.0": | |
| 80, | |
| "monoid@3.3.1": | |
| 61, | |
| "monoid-extras@0.0.0": | |
| 95, | |
| "monoid-extras@0.0.1": | |
| 177, | |
| "monoidal@0.1.0": | |
| 77, | |
| "monoidal@0.2.0": | |
| 62, | |
| "monoidal@0.3.0": | |
| 76, | |
| "monoidal@0.4.0": | |
| 77, | |
| "monoidal@0.5.0": | |
| 81, | |
| "monoidal@0.6.0": | |
| 75, | |
| "monoidal@0.7.0": | |
| 76, | |
| "monoidal@0.8.0": | |
| 161, | |
| "monoidal@0.9.0": | |
| 120, | |
| "monoidal@0.10.0": | |
| 55, | |
| "monoidal@0.12.0": | |
| 77, | |
| "monoidal@0.13.0": | |
| 89, | |
| "monoidal@0.14.0": | |
| 93, | |
| "monoidal@0.15.0": | |
| 93, | |
| "monoidal@0.16.0": | |
| 136, | |
| "moonshine@0.0.1": | |
| 547, | |
| "moonshine@0.0.2": | |
| -42, | |
| "moonshine@0.0.3": | |
| -52, | |
| "moonshine@1.0.0": | |
| -64, | |
| "moonshine@2.0.0": | |
| -66, | |
| "morello@0.1.0": | |
| -203, | |
| "morello@0.1.1": | |
| -193, | |
| "morello@0.2.0": | |
| -193, | |
| "morello@0.3.2": | |
| 210, | |
| "morello@0.4.0": | |
| 90, | |
| "most@0.1.0": | |
| 455, | |
| "mostly-dom@0.1.0": | |
| -282, | |
| "mote@0.1.0": | |
| 214, | |
| "mote@0.2.0": | |
| 214, | |
| "mote@1.0.0": | |
| 107, | |
| "mote@1.1.0": | |
| 190, | |
| "mote@2.0.0": | |
| 138, | |
| "mote@3.0.0": | |
| 95, | |
| "mote-runner@2.0.0": | |
| 219, | |
| "mote-runner@3.0.0": | |
| 193, | |
| "mote-runner@3.0.1": | |
| 194, | |
| "motsunabe@1.0.0": | |
| 119, | |
| "motsunabe@2.0.0": | |
| 120, | |
| "msgpack@0.0.0": | |
| 1008, | |
| "msgpack-msgpack@0.1.0": | |
| 247, | |
| "msgpack-msgpack@0.2.0": | |
| 248, | |
| "msgpack-msgpack@0.3.0": | |
| 262, | |
| "msgpack-msgpack@0.4.0": | |
| 269, | |
| "msgpack-msgpack@0.5.0": | |
| 411, | |
| "multiset-hashed@0.0.1": | |
| 164, | |
| "murmur3@1.0.0": | |
| 239, | |
| "murmur3@1.0.1": | |
| 112, | |
| "murmur3@1.0.2": | |
| 110, | |
| "mustache@0.1.0": | |
| 84, | |
| "mustache@2.0.0": | |
| 175, | |
| "mustache@2.1.0": | |
| 175, | |
| "mustache@3.0.0": | |
| 214, | |
| "mustache@3.0.1": | |
| 211, | |
| "mustache@3.0.2": | |
| 303, | |
| "mysql@0.1.0": | |
| 305, | |
| "mysql@0.1.1": | |
| 292, | |
| "mysql@0.1.2": | |
| 294, | |
| "mysql@0.1.3": | |
| 299, | |
| "mysql@0.2.0": | |
| 414, | |
| "mysql@0.2.1": | |
| 266, | |
| "mysql@0.3.0": | |
| 566, | |
| "mysql@1.0.0": | |
| 539, | |
| "mysql@1.1.0": | |
| 542, | |
| "mysql@2.0.0": | |
| 391, | |
| "mysql@2.0.1": | |
| 582, | |
| "mysql@2.1.0": | |
| 392, | |
| "mysql@2.1.1": | |
| 358, | |
| "mysql@3.0.0": | |
| 381, | |
| "mysql@3.0.1": | |
| 343, | |
| "mysql@3.1.0": | |
| 346, | |
| "mysql@3.2.0": | |
| 345, | |
| "mysql@3.3.0": | |
| 344, | |
| "mysql@3.4.0": | |
| 440, | |
| "mysql@3.4.1": | |
| 341, | |
| "mysql@4.0.0": | |
| 340, | |
| "mysql@4.1.0": | |
| 349, | |
| "mysql@4.1.1": | |
| 345, | |
| "mysql@5.0.0": | |
| 274, | |
| "mysql@6.0.0": | |
| 100, | |
| "mysql@6.0.1": | |
| 99, | |
| "nano-id@1.0.0": | |
| 160, | |
| "nano-id@1.0.1": | |
| 133, | |
| "nano-id@1.1.0": | |
| 131, | |
| "naporitan@0.1.0": | |
| 91, | |
| "naporitan@0.2.0": | |
| 88, | |
| "naporitan@1.0.0": | |
| 192, | |
| "naporitan@2.0.0": | |
| 46, | |
| "naturals@1.0.0": | |
| 55, | |
| "naturals@1.0.1": | |
| 69, | |
| "naturals@1.0.2": | |
| 68, | |
| "naturals@1.1.0": | |
| 69, | |
| "naturals@2.0.0": | |
| 69, | |
| "naturals@2.1.0": | |
| 68, | |
| "naturals@2.2.0": | |
| 302, | |
| "naturals@3.0.0": | |
| 78, | |
| "navigator@0.1.0": | |
| 46, | |
| "neo4j@0.1.0": | |
| 87, | |
| "neon@0.0.1": | |
| 65, | |
| "neon@0.0.2": | |
| 67, | |
| "neon@0.0.3": | |
| 110, | |
| "neon@0.0.4": | |
| 203, | |
| "neon@0.0.5": | |
| 47, | |
| "neon@0.0.6": | |
| 59, | |
| "neon@0.0.7": | |
| 81, | |
| "neon@0.0.8": | |
| 82, | |
| "neon@0.0.9": | |
| 82, | |
| "neon@0.0.10": | |
| 70, | |
| "neon@0.0.11": | |
| 70, | |
| "neon@0.0.12": | |
| 70, | |
| "neon@0.0.13": | |
| 117, | |
| "neon@0.0.14": | |
| 44, | |
| "neon@0.0.15": | |
| 54, | |
| "neon@0.0.16": | |
| 67, | |
| "neon@0.0.17": | |
| 66, | |
| "neon@0.0.18": | |
| 65, | |
| "neon@0.0.19": | |
| 106, | |
| "neon@0.0.20": | |
| 42, | |
| "neon@0.0.21": | |
| 59, | |
| "neon@0.0.22": | |
| 66, | |
| "neon@0.0.23": | |
| 66, | |
| "neon@0.0.24": | |
| 91, | |
| "neon@0.0.25": | |
| 97, | |
| "neon@0.0.26": | |
| 48, | |
| "neon@0.0.27": | |
| 64, | |
| "neon@0.0.28": | |
| 69, | |
| "neon@0.0.29": | |
| 65, | |
| "neon@0.0.30": | |
| 66, | |
| "neon@0.0.31": | |
| 74, | |
| "neon@0.0.32": | |
| 67, | |
| "neon@0.0.33": | |
| 129, | |
| "neon@0.0.34": | |
| 48, | |
| "neon@0.0.35": | |
| 52, | |
| "neon@0.0.36": | |
| 67, | |
| "neon@0.1.0": | |
| 65, | |
| "neon@0.1.1": | |
| 65, | |
| "neon@0.2.0": | |
| 131, | |
| "neon@0.2.1": | |
| 196, | |
| "neon@0.3.0": | |
| 90, | |
| "neon@0.4.2": | |
| 77, | |
| "neon@0.4.3": | |
| 94, | |
| "neon@0.4.4": | |
| -87, | |
| "neon@0.5.0": | |
| -87, | |
| "neon@0.5.1": | |
| -84, | |
| "neon@0.5.2": | |
| -185, | |
| "neon@0.5.3": | |
| -81, | |
| "neon@0.5.4": | |
| -72, | |
| "neon@0.6.0": | |
| 407, | |
| "neovim@0.0.1": | |
| 68, | |
| "neovim@0.0.2": | |
| 186, | |
| "neovim@0.0.3": | |
| 180, | |
| "neovim@0.0.4": | |
| 303, | |
| "neovim@0.0.5": | |
| 165, | |
| "neovim@0.0.6": | |
| 162, | |
| "nested-functor@0.1.0": | |
| 56, | |
| "nested-functor@0.2.0": | |
| 78, | |
| "nested-functor@0.2.1": | |
| 58, | |
| "newtype@0.1.0": | |
| 79, | |
| "newtype@1.0.0": | |
| 69, | |
| "newtype@1.1.0": | |
| 116, | |
| "newtype@1.2.0": | |
| 44, | |
| "newtype@1.3.0": | |
| 54, | |
| "newtype@2.0.0": | |
| 70, | |
| "newtype@3.0.0": | |
| 68, | |
| "newtype@4.0.0": | |
| 68, | |
| "newtype@5.0.0": | |
| 112, | |
| "newtype-operator@1.0.0": | |
| 57, | |
| "nextui@0.1.0": | |
| 156, | |
| "node-bcrypt@1.0.0": | |
| 484, | |
| "node-buffer@0.0.1": | |
| 59, | |
| "node-buffer@0.1.0": | |
| 77, | |
| "node-buffer@0.1.1": | |
| 75, | |
| "node-buffer@0.2.0": | |
| 131, | |
| "node-buffer@0.2.1": | |
| 62, | |
| "node-buffer@0.2.2": | |
| 50, | |
| "node-buffer@1.0.0": | |
| 72, | |
| "node-buffer@2.0.0": | |
| 72, | |
| "node-buffer@2.0.1": | |
| 81, | |
| "node-buffer@3.0.0": | |
| 70, | |
| "node-buffer@3.0.1": | |
| 149, | |
| "node-buffer@4.0.0": | |
| 52, | |
| "node-buffer@4.1.0": | |
| 69, | |
| "node-buffer@5.0.0": | |
| 68, | |
| "node-buffer@6.0.0": | |
| 89, | |
| "node-buffer@7.0.0": | |
| 71, | |
| "node-buffer@7.0.1": | |
| 84, | |
| "node-buffer@8.0.0": | |
| 103, | |
| "node-buffer-blob@1.0.0": | |
| 100, | |
| "node-child-process@0.0.1": | |
| 47, | |
| "node-child-process@0.2.0": | |
| 109, | |
| "node-child-process@0.3.0": | |
| 94, | |
| "node-child-process@0.3.1": | |
| 171, | |
| "node-child-process@0.3.2": | |
| 86, | |
| "node-child-process@0.4.0": | |
| 88, | |
| "node-child-process@0.4.1": | |
| 91, | |
| "node-child-process@0.4.2": | |
| 95, | |
| "node-child-process@0.5.0": | |
| 101, | |
| "node-child-process@0.5.1": | |
| 179, | |
| "node-child-process@0.6.0": | |
| -92, | |
| "node-child-process@0.6.1": | |
| 80, | |
| "node-child-process@1.0.0": | |
| 75, | |
| "node-child-process@2.0.0": | |
| -198, | |
| "node-child-process@3.0.0": | |
| 388, | |
| "node-child-process@3.0.1": | |
| -335, | |
| "node-child-process@4.0.0": | |
| 403, | |
| "node-child-process@5.0.0": | |
| 303, | |
| "node-child-process@6.0.0": | |
| 167, | |
| "node-child-process@7.0.0": | |
| 140, | |
| "node-child-process@7.1.0": | |
| 154, | |
| "node-child-process@8.0.0": | |
| 120, | |
| "node-child-process@9.0.0": | |
| 123, | |
| "node-coroutines@1.0.0": | |
| 303, | |
| "node-coroutines@2.0.0": | |
| 416, | |
| "node-crypto@0.1.0": | |
| 47, | |
| "node-crypto@0.2.0": | |
| 56, | |
| "node-crypto@0.2.1": | |
| 73, | |
| "node-crypto@0.2.2": | |
| 66, | |
| "node-datagram@2.0.0": | |
| 84, | |
| "node-datagram@3.0.0": | |
| 151, | |
| "node-datagram@4.0.0": | |
| 78, | |
| "node-domain@0.0.1": | |
| 44, | |
| "node-electron@0.0.2": | |
| -390, | |
| "node-events@0.0.1": | |
| 53, | |
| "node-events@0.0.2": | |
| 73, | |
| "node-events@0.0.3": | |
| 61, | |
| "node-events@0.0.4": | |
| 71, | |
| "node-events@0.0.5": | |
| 90, | |
| "node-events@0.0.6": | |
| 109, | |
| "node-fs@0.1.2": | |
| -65, | |
| "node-fs@0.1.3": | |
| -80, | |
| "node-fs@0.2.0": | |
| 79, | |
| "node-fs@0.2.1": | |
| 77, | |
| "node-fs@0.3.0": | |
| -75, | |
| "node-fs@0.4.0": | |
| 85, | |
| "node-fs@0.5.0": | |
| 81, | |
| "node-fs@0.6.0": | |
| 189, | |
| "node-fs@0.7.0": | |
| 85, | |
| "node-fs@0.7.1": | |
| 78, | |
| "node-fs@0.8.0": | |
| 88, | |
| "node-fs@0.8.1": | |
| 85, | |
| "node-fs@0.9.0": | |
| 86, | |
| "node-fs@0.9.1": | |
| 85, | |
| "node-fs@0.9.2": | |
| 186, | |
| "node-fs@0.10.0": | |
| 82, | |
| "node-fs@0.10.1": | |
| 69, | |
| "node-fs@0.10.2": | |
| 87, | |
| "node-fs@0.11.0": | |
| 84, | |
| "node-fs@1.0.0": | |
| 82, | |
| "node-fs@2.0.0": | |
| -203, | |
| "node-fs@3.0.0": | |
| 446, | |
| "node-fs@4.0.0": | |
| 327, | |
| "node-fs@4.0.1": | |
| 434, | |
| "node-fs@5.0.0": | |
| 195, | |
| "node-fs@5.0.1": | |
| 195, | |
| "node-fs@6.0.0": | |
| 138, | |
| "node-fs@6.1.0": | |
| 142, | |
| "node-fs@6.2.0": | |
| 250, | |
| "node-fs@7.0.0": | |
| 112, | |
| "node-fs@7.0.1": | |
| 102, | |
| "node-fs@8.0.0": | |
| 116, | |
| "node-fs@8.1.0": | |
| 114, | |
| "node-fs@8.1.1": | |
| 124, | |
| "node-fs-aff@0.1.0": | |
| 118, | |
| "node-fs-aff@0.1.1": | |
| 111, | |
| "node-fs-aff@0.1.2": | |
| 187, | |
| "node-fs-aff@0.2.0": | |
| 94, | |
| "node-fs-aff@0.2.1": | |
| 93, | |
| "node-fs-aff@0.3.0": | |
| 110, | |
| "node-fs-aff@0.3.1": | |
| 108, | |
| "node-fs-aff@0.4.0": | |
| 119, | |
| "node-fs-aff@0.5.0": | |
| 121, | |
| "node-fs-aff@0.6.0": | |
| 114, | |
| "node-fs-aff@1.0.0": | |
| 172, | |
| "node-fs-aff@2.0.0": | |
| -262, | |
| "node-fs-aff@3.0.0": | |
| 396, | |
| "node-fs-aff@4.0.0": | |
| 402, | |
| "node-fs-aff@5.0.0": | |
| 542, | |
| "node-fs-aff@6.0.0": | |
| 316, | |
| "node-fs-aff@7.0.0": | |
| 148, | |
| "node-fs-aff@8.0.0": | |
| 119, | |
| "node-fs-aff@9.0.0": | |
| 214, | |
| "node-fs-aff@9.1.0": | |
| 108, | |
| "node-fs-extra@0.1.0": | |
| 320, | |
| "node-fs-extra@0.1.1": | |
| 328, | |
| "node-fs-extra@0.1.2": | |
| 328, | |
| "node-he@0.1.0": | |
| 56, | |
| "node-he@0.2.0": | |
| 71, | |
| "node-he@0.3.0": | |
| 134, | |
| "node-http@0.1.0": | |
| 91, | |
| "node-http@0.1.1": | |
| 78, | |
| "node-http@0.1.2": | |
| 90, | |
| "node-http@0.1.3": | |
| 104, | |
| "node-http@0.1.4": | |
| 100, | |
| "node-http@0.1.5": | |
| 102, | |
| "node-http@0.1.6": | |
| 104, | |
| "node-http@0.1.7": | |
| 223, | |
| "node-http@0.2.0": | |
| 85, | |
| "node-http@0.3.0": | |
| 82, | |
| "node-http@0.3.1": | |
| 88, | |
| "node-http@0.4.0": | |
| 95, | |
| "node-http@0.4.1": | |
| 92, | |
| "node-http@1.0.0": | |
| 81, | |
| "node-http@1.1.0": | |
| 83, | |
| "node-http@1.2.0": | |
| 153, | |
| "node-http@1.3.0": | |
| 73, | |
| "node-http@2.0.0": | |
| 308, | |
| "node-http@3.0.0": | |
| 239, | |
| "node-http@3.0.1": | |
| 262, | |
| "node-http@4.0.0": | |
| 319, | |
| "node-http@4.1.0": | |
| 477, | |
| "node-http@4.2.0": | |
| 380, | |
| "node-http@5.0.0": | |
| 143, | |
| "node-http@5.0.1": | |
| 188, | |
| "node-http@5.0.2": | |
| 187, | |
| "node-http@6.0.0": | |
| 161, | |
| "node-http@7.0.0": | |
| 136, | |
| "node-http@8.0.0": | |
| 132, | |
| "node-irc@1.0.0": | |
| -233, | |
| "node-irc@1.0.1": | |
| -114, | |
| "node-mongodb@0.0.1": | |
| 81, | |
| "node-mongodb@0.0.2": | |
| 100, | |
| "node-mongodb@0.0.3": | |
| 100, | |
| "node-mongodb@0.0.6": | |
| 136, | |
| "node-mongodb@0.0.7": | |
| -397, | |
| "node-mongodb@0.0.8": | |
| 677, | |
| "node-mongodb@0.11.0": | |
| 518, | |
| "node-net@1.0.0": | |
| 722, | |
| "node-net@2.0.0": | |
| 152, | |
| "node-net@2.0.1": | |
| 151, | |
| "node-net@3.0.0": | |
| 121, | |
| "node-net@4.0.0": | |
| 122, | |
| "node-openurl@0.0.1": | |
| 438, | |
| "node-os@1.0.0": | |
| 62, | |
| "node-os@1.1.0": | |
| 63, | |
| "node-os@2.0.0": | |
| 330, | |
| "node-os@2.1.0": | |
| 326, | |
| "node-os@3.0.0": | |
| 155, | |
| "node-os@3.1.0": | |
| 139, | |
| "node-path@0.1.0": | |
| 56, | |
| "node-path@0.2.0": | |
| 137, | |
| "node-path@0.3.0": | |
| 47, | |
| "node-path@0.4.0": | |
| 52, | |
| "node-path@0.4.1": | |
| 61, | |
| "node-path@1.0.0": | |
| 73, | |
| "node-path@2.0.0": | |
| 60, | |
| "node-path@3.0.0": | |
| 73, | |
| "node-path@4.0.0": | |
| 113, | |
| "node-path@5.0.0": | |
| 45, | |
| "node-postgres@0.1.0": | |
| 104, | |
| "node-postgres@0.2.0": | |
| 116, | |
| "node-postgres@0.2.1": | |
| 97, | |
| "node-postgres@0.2.2": | |
| 99, | |
| "node-postgres@1.0.0": | |
| 139, | |
| "node-postgres@2.0.0": | |
| 271, | |
| "node-postgres@3.0.0": | |
| 350, | |
| "node-postgres@4.0.0": | |
| 299, | |
| "node-postgres@4.1.0": | |
| 303, | |
| "node-postgres@5.0.0": | |
| 243, | |
| "node-process@0.1.0": | |
| 141, | |
| "node-process@0.1.1": | |
| 74, | |
| "node-process@0.1.2": | |
| 90, | |
| "node-process@0.2.0": | |
| 100, | |
| "node-process@0.3.0": | |
| 98, | |
| "node-process@0.4.0": | |
| 98, | |
| "node-process@0.4.1": | |
| 205, | |
| "node-process@0.5.0": | |
| 89, | |
| "node-process@1.0.0": | |
| 60, | |
| "node-process@2.0.0": | |
| -199, | |
| "node-process@3.0.0": | |
| 384, | |
| "node-process@4.0.0": | |
| 402, | |
| "node-process@5.0.0": | |
| 518, | |
| "node-process@6.0.0": | |
| 200, | |
| "node-process@7.0.0": | |
| 106, | |
| "node-process@8.0.0": | |
| 77, | |
| "node-process@8.1.0": | |
| 92, | |
| "node-process@8.2.0": | |
| 100, | |
| "node-process@9.0.0": | |
| 95, | |
| "node-process@10.0.0": | |
| 86, | |
| "node-readable@0.0.1": | |
| 87, | |
| "node-readable@1.0.0": | |
| 165, | |
| "node-readable@1.0.1": | |
| 74, | |
| "node-readable@2.0.0": | |
| 65, | |
| "node-readable@2.1.0": | |
| 83, | |
| "node-readable@2.2.0": | |
| 83, | |
| "node-readable@3.0.0": | |
| 92, | |
| "node-readline@0.1.1": | |
| 63, | |
| "node-readline@0.1.2": | |
| 69, | |
| "node-readline@0.2.0": | |
| 77, | |
| "node-readline@0.3.0": | |
| 128, | |
| "node-readline@0.3.1": | |
| 45, | |
| "node-readline@0.4.0": | |
| 100, | |
| "node-readline@0.4.1": | |
| 101, | |
| "node-readline@0.5.0": | |
| 99, | |
| "node-readline@1.0.0": | |
| 84, | |
| "node-readline@2.0.0": | |
| 467, | |
| "node-readline@3.0.0": | |
| 446, | |
| "node-readline@3.0.1": | |
| 749, | |
| "node-readline@3.1.0": | |
| 602, | |
| "node-readline@4.0.0": | |
| 198, | |
| "node-readline@4.0.1": | |
| 237, | |
| "node-readline@5.0.0": | |
| 126, | |
| "node-readline@6.0.0": | |
| 111, | |
| "node-readline@7.0.0": | |
| 194, | |
| "node-readline-aff@0.1.0": | |
| 39, | |
| "node-readline-aff@0.1.1": | |
| 50, | |
| "node-readline-aff@0.1.2": | |
| 764, | |
| "node-readline-aff@0.2.0": | |
| 298, | |
| "node-readline-aff@0.3.0": | |
| 272, | |
| "node-redis@0.1.0": | |
| -157, | |
| "node-sentry@1.2.0": | |
| -246, | |
| "node-sqlite3@0.2.0": | |
| 170, | |
| "node-sqlite3@0.3.0": | |
| -156, | |
| "node-sqlite3@0.4.0": | |
| -165, | |
| "node-sqlite3@0.5.0": | |
| 499, | |
| "node-sqlite3@1.0.0": | |
| 467, | |
| "node-sqlite3@2.0.0": | |
| 469, | |
| "node-sqlite3@3.0.0": | |
| 415, | |
| "node-sqlite3@3.1.0": | |
| 267, | |
| "node-sqlite3@4.0.0": | |
| 262, | |
| "node-sqlite3@4.1.0": | |
| 279, | |
| "node-sqlite3@5.0.0": | |
| 278, | |
| "node-sqlite3@6.0.0": | |
| 277, | |
| "node-sqlite3@7.0.0": | |
| 128, | |
| "node-sqlite3@8.0.0": | |
| 218, | |
| "node-stream-buffers@0.1.0": | |
| 81, | |
| "node-stream-buffers@0.1.1": | |
| 73, | |
| "node-streams@0.1.0": | |
| 65, | |
| "node-streams@0.1.1": | |
| 65, | |
| "node-streams@0.1.2": | |
| 74, | |
| "node-streams@0.1.3": | |
| 67, | |
| "node-streams@0.1.4": | |
| 128, | |
| "node-streams@0.2.0": | |
| 88, | |
| "node-streams@0.3.0": | |
| 55, | |
| "node-streams@0.4.0": | |
| 84, | |
| "node-streams@0.4.1": | |
| 80, | |
| "node-streams@0.5.0": | |
| 70, | |
| "node-streams@0.6.0": | |
| 80, | |
| "node-streams@1.0.0": | |
| 85, | |
| "node-streams@2.0.0": | |
| 124, | |
| "node-streams@3.0.0": | |
| 52, | |
| "node-streams@3.1.0": | |
| 85, | |
| "node-streams@3.2.0": | |
| 81, | |
| "node-streams@3.3.0": | |
| 89, | |
| "node-streams@4.0.0": | |
| 74, | |
| "node-streams@4.0.1": | |
| 91, | |
| "node-streams@5.0.0": | |
| 73, | |
| "node-streams@6.0.0": | |
| 169, | |
| "node-streams@7.0.0": | |
| 77, | |
| "node-streams-aff@1.0.0": | |
| 90, | |
| "node-streams-aff@1.1.0": | |
| 100, | |
| "node-streams-aff@2.0.0": | |
| 99, | |
| "node-streams-aff@3.0.0": | |
| 102, | |
| "node-streams-aff@4.0.0": | |
| 103, | |
| "node-streams-aff@4.0.1": | |
| 98, | |
| "node-telegram-bot-api@0.1.0": | |
| 110, | |
| "node-telegram-bot-api@0.2.0": | |
| 455, | |
| "node-telegram-bot-api@0.3.0": | |
| 422, | |
| "node-telegram-bot-api@0.4.0": | |
| -384, | |
| "node-telegram-bot-api@0.5.0": | |
| -374, | |
| "node-telegram-bot-api@0.6.0": | |
| 589, | |
| "node-telegram-bot-api@0.7.0": | |
| 447, | |
| "node-telegram-bot-api@0.7.1": | |
| 440, | |
| "node-telegram-bot-api@1.0.0": | |
| 491, | |
| "node-telegram-bot-api@1.1.0": | |
| 468, | |
| "node-telegram-bot-api@2.0.0": | |
| 322, | |
| "node-telegram-bot-api@3.0.0": | |
| 384, | |
| "node-telegram-bot-api@4.0.0": | |
| 221, | |
| "node-thunk@0.1.0": | |
| 44, | |
| "node-thunk@0.1.1": | |
| 70, | |
| "node-thunk@0.1.2": | |
| 71, | |
| "node-url@0.1.0": | |
| 79, | |
| "node-url@0.1.1": | |
| 68, | |
| "node-url@0.1.2": | |
| 116, | |
| "node-url@1.0.0": | |
| 48, | |
| "node-url@2.0.0": | |
| 79, | |
| "node-url@3.0.0": | |
| 70, | |
| "node-url@4.0.0": | |
| 77, | |
| "node-url@5.0.0": | |
| 73, | |
| "node-url@6.0.0": | |
| 140, | |
| "node-uuid@0.1.0": | |
| 69, | |
| "node-uuid@0.2.0": | |
| -95, | |
| "node-uuid@0.3.0": | |
| -105, | |
| "node-uuid@0.3.1": | |
| -104, | |
| "node-uuid@0.4.0": | |
| -108, | |
| "node-uuid@0.4.1": | |
| -158, | |
| "node-uuid@0.5.0": | |
| 195, | |
| "node-uuid@0.6.0": | |
| 94, | |
| "node-uuid@0.6.1": | |
| 82, | |
| "node-webkit@0.0.1": | |
| 52, | |
| "node-webkit@0.0.2": | |
| 85, | |
| "node-webkit@0.0.3": | |
| 78, | |
| "node-webkit@0.0.4": | |
| 64, | |
| "node-webkit@0.1.0": | |
| -73, | |
| "node-webkit@0.1.1": | |
| -81, | |
| "node-webkit@0.1.2": | |
| -136, | |
| "node-websocket@0.0.2": | |
| 675, | |
| "node-websocket@0.0.3": | |
| 658, | |
| "nodemailer@0.1.0": | |
| 478, | |
| "nodemailer@1.0.0": | |
| 309, | |
| "nodemailer@2.0.0": | |
| 370, | |
| "nodemailer@2.0.1": | |
| 341, | |
| "nodemailer@2.0.2": | |
| 315, | |
| "nodemailer@3.0.0": | |
| 263, | |
| "nodemailer@4.0.0": | |
| 91, | |
| "nodemailer@4.0.1": | |
| 96, | |
| "nodetrout@0.0.1": | |
| 536, | |
| "nonbili-dom@0.1.0": | |
| 416, | |
| "nonbili-dom@0.2.0": | |
| 406, | |
| "nonbili-dom@0.2.1": | |
| 511, | |
| "nonbili-dom@0.3.0": | |
| 392, | |
| "nonempty@1.1.1": | |
| 51, | |
| "nonempty@2.0.0": | |
| 103, | |
| "nonempty@3.0.0": | |
| 67, | |
| "nonempty@4.0.0": | |
| 75, | |
| "nonempty@4.1.0": | |
| 75, | |
| "nonempty@4.1.1": | |
| 140, | |
| "nonempty@4.2.0": | |
| 52, | |
| "nonempty@4.3.0": | |
| 89, | |
| "nonempty@5.0.0": | |
| 86, | |
| "nonempty@6.0.0": | |
| 99, | |
| "nonempty@6.1.0": | |
| 98, | |
| "nonempty@7.0.0": | |
| 80, | |
| "nonempty-arrays@0.0.2": | |
| -121, | |
| "nonempty-arrays@0.0.3": | |
| -50, | |
| "nonempty-arrays@0.1.0": | |
| -74, | |
| "nonempty-arrays@0.2.0": | |
| 73, | |
| "nonempty-arrays@0.3.0": | |
| 92, | |
| "now@1.0.0": | |
| 71, | |
| "now@2.0.0": | |
| 226, | |
| "now@3.0.0": | |
| 385, | |
| "now@4.0.0": | |
| 145, | |
| "now@5.0.0": | |
| 106, | |
| "now@6.0.0": | |
| 87, | |
| "npm-package-json@1.0.0": | |
| 502, | |
| "npm-package-json@1.1.0": | |
| 605, | |
| "npm-package-json@1.2.0": | |
| 481, | |
| "npm-package-json@2.0.0": | |
| 128, | |
| "nullable@0.1.0": | |
| 60, | |
| "nullable@0.1.1": | |
| 66, | |
| "nullable@0.2.0": | |
| 125, | |
| "nullable@0.2.1": | |
| 49, | |
| "nullable@1.0.0": | |
| 50, | |
| "nullable@1.0.1": | |
| 71, | |
| "nullable@2.0.0": | |
| 63, | |
| "nullable@3.0.0": | |
| 82, | |
| "nullable@4.0.0": | |
| 70, | |
| "nullable@4.1.0": | |
| 144, | |
| "nullable@4.1.1": | |
| 51, | |
| "nullable@5.0.0": | |
| 61, | |
| "nullable@6.0.0": | |
| 72, | |
| "nullable-safe@1.0.0": | |
| 78, | |
| "nullable-safe@1.1.0": | |
| 73, | |
| "number-format@0.1.0": | |
| 71, | |
| "number-format@0.2.0": | |
| 62, | |
| "number-format@0.2.1": | |
| 77, | |
| "number-format@0.3.0": | |
| 139, | |
| "numbers@1.0.0": | |
| 45, | |
| "numbers@2.0.0": | |
| 52, | |
| "numbers@3.0.0": | |
| 70, | |
| "numbers@4.0.0": | |
| 65, | |
| "numbers@4.1.0": | |
| 66, | |
| "numbers@4.2.0": | |
| 73, | |
| "numbers@5.0.0": | |
| 143, | |
| "numbers@6.0.0": | |
| 67, | |
| "numbers@7.0.0": | |
| 55, | |
| "numbers@8.0.0": | |
| 71, | |
| "numbers@9.0.0": | |
| 70, | |
| "numbox@0.0.1": | |
| 89, | |
| "numbox@0.0.2": | |
| 82, | |
| "numbox@0.0.3": | |
| 168, | |
| "numbox@0.0.4": | |
| 97, | |
| "numerics@0.1.0": | |
| 1984, | |
| "numerics@0.1.1": | |
| 1959, | |
| "numerics@0.1.2": | |
| 250, | |
| "numerics-012@0.1.0": | |
| 1969, | |
| "numerics-012@0.1.1": | |
| 2002, | |
| "oak@0.1.0": | |
| 487, | |
| "oak@0.1.1": | |
| 348, | |
| "oak@0.1.2": | |
| 336, | |
| "oak@0.1.3": | |
| 349, | |
| "oak@0.1.4": | |
| 344, | |
| "oak@0.1.5": | |
| 345, | |
| "oak@0.1.6": | |
| 344, | |
| "oak@0.1.7": | |
| 450, | |
| "oak@0.2.0": | |
| 349, | |
| "oak@0.3.0": | |
| 328, | |
| "oak@0.4.0": | |
| 340, | |
| "oak@0.4.1": | |
| 347, | |
| "oak@0.4.2": | |
| 348, | |
| "oak@0.5.0": | |
| 343, | |
| "oak@0.5.1": | |
| 350, | |
| "oak@0.6.0": | |
| 165, | |
| "oak@0.6.1": | |
| 189, | |
| "oak@0.6.4": | |
| 177, | |
| "oak@0.6.5": | |
| 188, | |
| "oak@0.6.6": | |
| 186, | |
| "oak@0.6.7": | |
| 187, | |
| "oak@0.6.8": | |
| 268, | |
| "oak@0.6.9": | |
| 176, | |
| "oak@0.7.0": | |
| 170, | |
| "oak@0.8.0": | |
| 180, | |
| "oak@0.8.1": | |
| 187, | |
| "oak@1.0.0": | |
| 167, | |
| "oak@1.1.0": | |
| 169, | |
| "oak@1.1.2": | |
| 170, | |
| "oak@1.1.3": | |
| 285, | |
| "oak@1.1.4": | |
| 162, | |
| "oak@1.1.5": | |
| 153, | |
| "oak@1.1.6": | |
| 167, | |
| "oak@1.1.7": | |
| 172, | |
| "oak@1.1.8": | |
| 171, | |
| "oak@1.1.9": | |
| 176, | |
| "oak@2.1.0": | |
| 168, | |
| "oak-ajax@0.6.2": | |
| 405, | |
| "oak-ajax@0.6.3": | |
| 374, | |
| "oak-ajax@0.7.0": | |
| 352, | |
| "oak-ajax@0.7.1": | |
| 358, | |
| "oak-ajax@0.8.0": | |
| 390, | |
| "oak-ajax@1.0.0": | |
| 414, | |
| "oak-debug@0.6.10": | |
| 61, | |
| "oak-debug@0.7.0": | |
| 371, | |
| "oak-debug@0.8.1": | |
| 257, | |
| "oak-debug@1.0.0": | |
| 202, | |
| "object-maps@0.1.1": | |
| 137, | |
| "oboe@0.1.0": | |
| -56, | |
| "oboe@0.2.0": | |
| -71, | |
| "oboe@0.3.0": | |
| 138, | |
| "observable@1.0.0": | |
| 72, | |
| "observable@1.1.0": | |
| 66, | |
| "observable@1.2.0": | |
| 73, | |
| "observable@1.3.0": | |
| 80, | |
| "observable@1.4.0": | |
| 83, | |
| "observable@2.0.0": | |
| 76, | |
| "observable@2.1.0": | |
| 153, | |
| "observable@2.2.0": | |
| 73, | |
| "observable@3.0.0": | |
| 202, | |
| "observable-channel@1.0.0": | |
| 77, | |
| "observable-channel@2.0.0": | |
| 209, | |
| "observable-classy@0.1.0": | |
| 75, | |
| "observable-lift@0.1.0": | |
| 152, | |
| "observable-lift@0.2.0": | |
| 84, | |
| "observable-lift@0.2.1": | |
| 53, | |
| "observable-time@1.0.0": | |
| 74, | |
| "observable-time@2.0.0": | |
| 224, | |
| "ocarina@0.0.0": | |
| -408, | |
| "ocarina@0.0.1": | |
| -414, | |
| "ocarina@0.0.2": | |
| -480, | |
| "ocarina@0.0.3": | |
| -583, | |
| "ocarina@0.0.4": | |
| -444, | |
| "ocarina@0.1.0": | |
| -453, | |
| "ocarina@0.1.1": | |
| -464, | |
| "ocarina@0.1.2": | |
| -471, | |
| "ocarina@0.1.3": | |
| -469, | |
| "ocarina@0.1.4": | |
| -550, | |
| "ocarina@0.1.5": | |
| -445, | |
| "ocarina@0.2.0": | |
| -462, | |
| "ocarina@0.2.1": | |
| -469, | |
| "ocarina@0.2.2": | |
| -564, | |
| "ocarina@0.2.3": | |
| -454, | |
| "ocarina@0.2.4": | |
| -448, | |
| "ocarina@0.3.0": | |
| -467, | |
| "ocarina@0.3.1": | |
| -476, | |
| "ocarina@0.3.2": | |
| -470, | |
| "ocarina@0.3.3": | |
| -487, | |
| "ocarina@0.3.4": | |
| -619, | |
| "ocarina@0.3.5": | |
| -443, | |
| "ocarina@0.3.6": | |
| -445, | |
| "ocarina@0.3.7": | |
| -468, | |
| "ocarina@0.3.8": | |
| -469, | |
| "ocarina@0.3.9": | |
| -465, | |
| "ocarina@0.3.10": | |
| -585, | |
| "ocarina@0.3.11": | |
| -450, | |
| "ocarina@0.3.12": | |
| -454, | |
| "ocarina@0.3.13": | |
| -471, | |
| "ocarina@0.3.14": | |
| -468, | |
| "ocarina@0.3.15": | |
| -465, | |
| "ocarina@0.4.0": | |
| -471, | |
| "ocarina@0.4.1": | |
| -557, | |
| "ocarina@0.4.2": | |
| -447, | |
| "ocarina@0.4.3": | |
| -461, | |
| "ocarina@0.4.4": | |
| -467, | |
| "ocarina@0.4.5": | |
| -596, | |
| "ocarina@0.4.6": | |
| -452, | |
| "ocarina@0.4.7": | |
| -455, | |
| "ocarina@0.4.8": | |
| -466, | |
| "ocarina@0.4.9": | |
| -467, | |
| "ocarina@0.5.0": | |
| -468, | |
| "ocarina@0.5.1": | |
| -471, | |
| "ocarina@0.5.2": | |
| -565, | |
| "ocarina@0.5.3": | |
| -446, | |
| "ocarina@0.5.4": | |
| -452, | |
| "ocarina@0.5.5": | |
| -465, | |
| "ocarina@0.5.6": | |
| -473, | |
| "ocarina@0.5.7": | |
| -568, | |
| "ocarina@0.5.8": | |
| -473, | |
| "ocarina@0.5.9": | |
| -449, | |
| "ocarina@0.5.10": | |
| -415, | |
| "ocarina@0.5.11": | |
| -417, | |
| "ocarina@0.6.0": | |
| -417, | |
| "ocarina@0.6.1": | |
| -420, | |
| "ocarina@0.6.2": | |
| -523, | |
| "ocarina@1.2.0": | |
| -468, | |
| "ocarina@1.2.1": | |
| -453, | |
| "ocarina@1.3.0": | |
| -471, | |
| "ocarina@1.5.2": | |
| -461, | |
| "ocelot@0.16.1": | |
| 845, | |
| "ocelot@0.16.2": | |
| 829, | |
| "ocelot@0.16.3": | |
| 942, | |
| "ocelot@0.16.4": | |
| 791, | |
| "ocelot@0.16.5": | |
| 804, | |
| "ocelot@0.16.6": | |
| 807, | |
| "ocelot@0.16.7": | |
| 888, | |
| "ocelot@0.16.8": | |
| 805, | |
| "ocelot@0.16.9": | |
| 784, | |
| "ocelot@0.16.10": | |
| 809, | |
| "ocelot@0.17.0": | |
| 822, | |
| "ocelot@0.18.0": | |
| 815, | |
| "ocelot@0.18.1": | |
| 953, | |
| "ocelot@0.18.2": | |
| 803, | |
| "ocelot@0.18.3": | |
| 787, | |
| "ocelot@0.19.0": | |
| 811, | |
| "ocelot@0.19.1": | |
| 820, | |
| "ochadzuke@0.1.0": | |
| 478, | |
| "ogmarkup@3.0.0": | |
| 83, | |
| "ogmarkup@3.1.0": | |
| 179, | |
| "ogmarkup@4.0.0": | |
| 71, | |
| "ogmarkup@5.0.0": | |
| 308, | |
| "ohyes@0.1.0": | |
| 203, | |
| "ohyes@1.0.0": | |
| 176, | |
| "ohyes@1.1.0": | |
| 180, | |
| "ohyes@2.0.0": | |
| 271, | |
| "ohyes@2.1.0": | |
| -367, | |
| "oidc-crypt-utils@1.0.0": | |
| 153, | |
| "oidc-crypt-utils@1.1.0": | |
| 150, | |
| "oidc-crypt-utils@3.0.0": | |
| 89, | |
| "oidc-crypt-utils@4.0.0": | |
| 91, | |
| "oidc-crypt-utils@5.0.0": | |
| 411, | |
| "oidc-crypt-utils@6.0.0": | |
| 545, | |
| "oidc-crypt-utils@7.0.0": | |
| 796, | |
| "oidc-crypt-utils@7.0.1": | |
| 805, | |
| "oldschool@0.1.0": | |
| 159, | |
| "oo-ffi@0.0.1": | |
| 53, | |
| "oo-ffi@0.0.2": | |
| 78, | |
| "oo-ffi@0.0.3": | |
| 64, | |
| "oo-ffi@0.0.4": | |
| 75, | |
| "oo-ffi@0.0.5": | |
| 110, | |
| "oo-ffi@0.0.6": | |
| 44, | |
| "oo-ffi@1.0.0": | |
| 62, | |
| "open-folds@1.0.1": | |
| 70, | |
| "open-folds@2.0.0": | |
| 102, | |
| "open-folds@3.0.0": | |
| 208, | |
| "open-folds@3.1.0": | |
| 102, | |
| "open-folds@4.0.0": | |
| 56, | |
| "open-folds@5.0.0": | |
| 105, | |
| "open-folds@5.1.0": | |
| 106, | |
| "open-folds@5.2.0": | |
| 107, | |
| "open-folds@6.0.0": | |
| 93, | |
| "open-folds@6.1.0": | |
| 94, | |
| "open-folds@6.2.0": | |
| 198, | |
| "open-folds@6.3.0": | |
| 90, | |
| "open-memoize@2.0.1": | |
| 50, | |
| "open-memoize@3.0.0": | |
| 155, | |
| "open-memoize@4.0.0": | |
| 193, | |
| "open-memoize@4.0.1": | |
| 188, | |
| "open-memoize@5.0.0": | |
| 135, | |
| "open-memoize@5.2.0": | |
| 181, | |
| "open-memoize@6.0.0": | |
| 95, | |
| "open-memoize@6.1.0": | |
| 83, | |
| "open-mkdirp-aff@1.1.0": | |
| 156, | |
| "open-pairing@1.0.0": | |
| 77, | |
| "open-pairing@1.1.0": | |
| 78, | |
| "open-pairing@1.2.0": | |
| 81, | |
| "open-pairing@1.3.0": | |
| 79, | |
| "open-pairing@1.4.0": | |
| 157, | |
| "open-pairing@2.0.0": | |
| -164, | |
| "open-pairing@3.0.0": | |
| -220, | |
| "open-pairing@4.0.0": | |
| 318, | |
| "open-pairing@5.0.0": | |
| 129, | |
| "open-pairing@5.1.0": | |
| 129, | |
| "open-pairing@6.0.0": | |
| 99, | |
| "open-pairing@6.1.0": | |
| 99, | |
| "openapi@0.0.2": | |
| 285, | |
| "openapi@0.0.3": | |
| 142, | |
| "openapi@0.0.4": | |
| 141, | |
| "openapi@0.0.5": | |
| 144, | |
| "openapi@0.0.6": | |
| 152, | |
| "openapi@0.0.7": | |
| 151, | |
| "openapi@0.0.8": | |
| 154, | |
| "optic@0.3.0": | |
| -76, | |
| "optic@0.4.0": | |
| 162, | |
| "optic@0.5.0": | |
| 75, | |
| "optic@0.7.0": | |
| 75, | |
| "optic@0.8.0": | |
| 91, | |
| "optic@0.9.0": | |
| 87, | |
| "optic@0.9.1": | |
| 157, | |
| "optimizely-api@0.1.0": | |
| -429, | |
| "optimizely-api@0.2.0": | |
| -393, | |
| "optimizely-api@0.3.0": | |
| -409, | |
| "optimizely-api@0.3.1": | |
| -417, | |
| "option@1.0.0": | |
| 641, | |
| "option@1.0.1": | |
| 648, | |
| "option@1.0.2": | |
| 733, | |
| "option@1.1.0": | |
| 619, | |
| "option@2.0.0": | |
| 619, | |
| "option@2.1.0": | |
| 642, | |
| "option@3.0.0": | |
| 640, | |
| "option@3.1.0": | |
| 641, | |
| "option@3.1.1": | |
| 645, | |
| "option@3.1.2": | |
| 723, | |
| "option@4.0.0": | |
| 630, | |
| "option@5.0.0": | |
| 635, | |
| "option@5.0.1": | |
| 637, | |
| "option@6.0.0": | |
| 698, | |
| "option@6.0.1": | |
| 548, | |
| "option@6.1.0": | |
| 549, | |
| "option@7.0.0": | |
| 566, | |
| "option@8.0.0": | |
| 567, | |
| "option@9.0.0": | |
| 140, | |
| "optional@1.0.0": | |
| 292, | |
| "optional@2.0.0": | |
| 254, | |
| "options@0.0.1": | |
| 53, | |
| "options@0.1.0": | |
| 61, | |
| "options@0.2.0": | |
| 86, | |
| "options@0.2.1": | |
| 73, | |
| "options@0.3.0": | |
| 75, | |
| "options@0.4.0": | |
| 174, | |
| "options@0.5.0": | |
| 91, | |
| "options@0.5.1": | |
| 71, | |
| "options@0.5.2": | |
| 77, | |
| "options@0.6.0": | |
| 84, | |
| "options@1.0.0": | |
| 81, | |
| "options@2.0.0": | |
| 228, | |
| "options@3.0.0": | |
| 225, | |
| "options@3.1.0": | |
| 392, | |
| "options@4.0.0": | |
| 135, | |
| "options@5.0.0": | |
| 136, | |
| "options@6.0.0": | |
| 105, | |
| "options@7.0.0": | |
| 93, | |
| "options-extra@0.1.0": | |
| 115, | |
| "options-extra@0.2.0": | |
| 201, | |
| "optlicative@4.0.3": | |
| 711, | |
| "optlicative@5.0.0": | |
| 142, | |
| "optlicative@5.1.0": | |
| 154, | |
| "optlicative@5.2.0": | |
| 163, | |
| "optlicative@6.0.0": | |
| 164, | |
| "optlicative@6.0.1": | |
| 167, | |
| "optparse@0.2.0": | |
| 179, | |
| "optparse@0.2.1": | |
| 295, | |
| "optparse@1.0.0": | |
| 170, | |
| "optparse@2.0.0": | |
| 168, | |
| "optparse@3.0.0": | |
| 177, | |
| "optparse@3.0.1": | |
| 182, | |
| "optparse@4.1.0": | |
| -216, | |
| "optparse@5.0.0": | |
| -367, | |
| "ordered-collections@1.0.0": | |
| 207, | |
| "ordered-collections@1.1.0": | |
| 86, | |
| "ordered-collections@1.2.0": | |
| 84, | |
| "ordered-collections@1.3.0": | |
| 94, | |
| "ordered-collections@1.4.0": | |
| 97, | |
| "ordered-collections@1.5.0": | |
| 98, | |
| "ordered-collections@1.6.0": | |
| 105, | |
| "ordered-collections@1.6.1": | |
| 180, | |
| "ordered-collections@2.0.0": | |
| 90, | |
| "ordered-collections@2.0.1": | |
| 76, | |
| "ordered-collections@2.0.2": | |
| 90, | |
| "ordered-collections@3.0.0": | |
| 87, | |
| "ordered-set@0.2.0": | |
| 88, | |
| "ordered-set@0.4.0": | |
| 199, | |
| "orders@0.1.2": | |
| 64, | |
| "orders@1.0.0": | |
| 80, | |
| "orders@2.0.0": | |
| 123, | |
| "orders@2.0.1": | |
| 46, | |
| "orders@3.0.0": | |
| 58, | |
| "orders@4.0.0": | |
| 72, | |
| "orders@5.0.0": | |
| 69, | |
| "orders@6.0.0": | |
| 69, | |
| "ordinals@1.0.0": | |
| 105, | |
| "ordinals@2.0.0": | |
| 80, | |
| "outwatch@0.7.0": | |
| 806, | |
| "owoify@1.0.0": | |
| 84, | |
| "owoify@1.1.0": | |
| 78, | |
| "owoify@1.1.1": | |
| 91, | |
| "owoify@1.1.2": | |
| 100, | |
| "p5@0.1.0": | |
| 320, | |
| "p5@0.2.0": | |
| 318, | |
| "p5@0.3.0": | |
| 418, | |
| "p5@0.4.0": | |
| 316, | |
| "p5@0.5.0": | |
| 296, | |
| "p5@0.6.0": | |
| 316, | |
| "p5@0.7.0": | |
| 319, | |
| "p5@0.7.1": | |
| 321, | |
| "p5@0.8.0": | |
| 330, | |
| "p5@0.9.0": | |
| 321, | |
| "p5@0.10.0": | |
| 412, | |
| "p5@0.11.0": | |
| 304, | |
| "painting@0.0.0": | |
| -159, | |
| "pair@0.1.0": | |
| 71, | |
| "pair@0.1.1": | |
| 89, | |
| "pairing@1.0.0": | |
| 79, | |
| "pairing@1.1.0": | |
| 151, | |
| "pairing@1.2.0": | |
| 61, | |
| "pairing@1.3.0": | |
| 67, | |
| "pairing@1.4.0": | |
| 76, | |
| "pairing@2.0.0": | |
| 286, | |
| "pairing@3.0.0": | |
| -222, | |
| "pairing@4.0.0": | |
| 369, | |
| "pairing@5.0.0": | |
| 116, | |
| "pairing@5.1.0": | |
| 108, | |
| "pairs@1.0.0": | |
| 46, | |
| "pairs@2.0.0": | |
| 88, | |
| "pairs@3.0.0": | |
| 74, | |
| "pairs@4.0.0": | |
| 195, | |
| "pairs@5.0.0": | |
| 354, | |
| "pairs@6.0.0": | |
| 268, | |
| "pairs@7.0.0": | |
| 138, | |
| "pairs@8.0.0": | |
| 92, | |
| "pairs@9.0.0": | |
| 98, | |
| "pako@0.1.0": | |
| 152, | |
| "pako@0.1.1": | |
| 296, | |
| "pako@0.2.0": | |
| 296, | |
| "pako@0.3.0": | |
| 55, | |
| "pako@0.4.0": | |
| 611, | |
| "panda@0.9.1": | |
| 486, | |
| "panda@0.9.2": | |
| 483, | |
| "panda@0.10.0": | |
| 500, | |
| "panda@0.10.1": | |
| 508, | |
| "panda@0.10.2": | |
| 580, | |
| "panda@0.11.0": | |
| 462, | |
| "parallel@0.1.0": | |
| 50, | |
| "parallel@0.2.0": | |
| 70, | |
| "parallel@0.2.1": | |
| 77, | |
| "parallel@0.4.0": | |
| 78, | |
| "parallel@0.5.0": | |
| 78, | |
| "parallel@0.5.1": | |
| 82, | |
| "parallel@1.0.0": | |
| 135, | |
| "parallel@1.1.0": | |
| 68, | |
| "parallel@2.0.0": | |
| 150, | |
| "parallel@2.1.0": | |
| 119, | |
| "parallel@3.0.0": | |
| 143, | |
| "parallel@3.1.0": | |
| 135, | |
| "parallel@3.2.0": | |
| 133, | |
| "parallel@3.3.0": | |
| 223, | |
| "parallel@3.3.1": | |
| 122, | |
| "parallel@4.0.0": | |
| 81, | |
| "parallel@5.0.0": | |
| 81, | |
| "parallel@6.0.0": | |
| 80, | |
| "parseint@0.0.0": | |
| 67, | |
| "parseint@1.0.0": | |
| 131, | |
| "parseint@1.1.0": | |
| 55, | |
| "parseint@1.1.1": | |
| 57, | |
| "parsers@0.0.1": | |
| 223, | |
| "parsers@0.1.0": | |
| 196, | |
| "parsers@0.1.1": | |
| 193, | |
| "parsers@0.1.2": | |
| 196, | |
| "parsers@0.1.3": | |
| 194, | |
| "parsers@0.1.4": | |
| 317, | |
| "parsers@0.1.5": | |
| 188, | |
| "parsers@0.1.6": | |
| 176, | |
| "parsers@0.1.7": | |
| 173, | |
| "parsers@0.2.0": | |
| 326, | |
| "parsing@0.1.1": | |
| -64, | |
| "parsing@0.1.2": | |
| -75, | |
| "parsing@0.1.3": | |
| -151, | |
| "parsing@0.1.4": | |
| -102, | |
| "parsing@0.1.5": | |
| -70, | |
| "parsing@0.2.0": | |
| 76, | |
| "parsing@0.3.0": | |
| 90, | |
| "parsing@0.3.1": | |
| 82, | |
| "parsing@0.4.0": | |
| 95, | |
| "parsing@0.5.0": | |
| 89, | |
| "parsing@0.5.1": | |
| 174, | |
| "parsing@0.6.1": | |
| 75, | |
| "parsing@0.7.0": | |
| 64, | |
| "parsing@0.7.1": | |
| 79, | |
| "parsing@0.7.2": | |
| 84, | |
| "parsing@0.8.0": | |
| 95, | |
| "parsing@0.8.1": | |
| 172, | |
| "parsing@1.0.0": | |
| 84, | |
| "parsing@2.0.0": | |
| 121, | |
| "parsing@2.1.0": | |
| 120, | |
| "parsing@3.0.0": | |
| 174, | |
| "parsing@3.0.1": | |
| 161, | |
| "parsing@3.1.0": | |
| 153, | |
| "parsing@3.2.0": | |
| 149, | |
| "parsing@3.2.1": | |
| 280, | |
| "parsing@4.0.0": | |
| 184, | |
| "parsing@4.1.0": | |
| 152, | |
| "parsing@4.2.0": | |
| 160, | |
| "parsing@4.2.1": | |
| 171, | |
| "parsing@4.2.2": | |
| 251, | |
| "parsing@4.3.0": | |
| 171, | |
| "parsing@4.3.1": | |
| 174, | |
| "parsing@5.0.0": | |
| 259, | |
| "parsing@5.0.1": | |
| 146, | |
| "parsing@5.0.2": | |
| 142, | |
| "parsing@5.0.3": | |
| 152, | |
| "parsing@5.1.0": | |
| 157, | |
| "parsing@6.0.0": | |
| 103, | |
| "parsing@6.0.1": | |
| 186, | |
| "parsing@6.0.2": | |
| 99, | |
| "parsing@7.0.0": | |
| 84, | |
| "parsing@7.0.1": | |
| 92, | |
| "parsing@7.1.0": | |
| 103, | |
| "parsing@7.2.0": | |
| 99, | |
| "parsing@8.0.0": | |
| 100, | |
| "parsing@8.1.0": | |
| 106, | |
| "parsing@8.2.0": | |
| 178, | |
| "parsing@8.3.0": | |
| 88, | |
| "parsing@8.4.0": | |
| 85, | |
| "parsing@9.0.0": | |
| 81, | |
| "parsing@9.1.0": | |
| 96, | |
| "parsing@10.0.0": | |
| 102, | |
| "parsing@10.1.0": | |
| 94, | |
| "parsing-dataview@1.0.0": | |
| 300, | |
| "parsing-dataview@1.0.1": | |
| 392, | |
| "parsing-dataview@1.0.2": | |
| 281, | |
| "parsing-dataview@1.1.0": | |
| 243, | |
| "parsing-dataview@1.1.1": | |
| 258, | |
| "parsing-dataview@2.0.0": | |
| 114, | |
| "parsing-dataview@2.0.1": | |
| 113, | |
| "parsing-dataview@2.1.0": | |
| 120, | |
| "parsing-dataview@3.0.0": | |
| 103, | |
| "parsing-dataview@3.1.0": | |
| 220, | |
| "parsing-expect@0.0.1": | |
| 185, | |
| "parsing-expect@0.0.2": | |
| 178, | |
| "parsing-expect@0.0.3": | |
| 193, | |
| "parsing-foreign@0.0.1": | |
| 301, | |
| "parsing-foreign@0.0.2": | |
| 297, | |
| "parsing-hexadecimal@0.0.1": | |
| 187, | |
| "parsing-hexadecimal@0.0.2": | |
| 350, | |
| "parsing-hexadecimal@0.0.3": | |
| -187, | |
| "parsing-repetition@0.0.1": | |
| 175, | |
| "parsing-repetition@0.0.2": | |
| 183, | |
| "parsing-repetition@0.0.3": | |
| 207, | |
| "parsing-repetition@0.0.4": | |
| 207, | |
| "parsing-repetition@0.0.5": | |
| 214, | |
| "parsing-repetition@0.0.6": | |
| 293, | |
| "parsing-repetition@0.0.7": | |
| 41, | |
| "parsing-repetition@0.0.8": | |
| 114, | |
| "parsing-replace@1.0.0": | |
| 197, | |
| "parsing-replace@1.0.1": | |
| 202, | |
| "parsing-replace@1.0.2": | |
| 204, | |
| "parsing-replace@2.0.0": | |
| 109, | |
| "parsing-replace@2.0.1": | |
| 110, | |
| "parsing-replace@2.0.2": | |
| 233, | |
| "parsing-uuid@0.0.1": | |
| 210, | |
| "parsing-uuid@0.0.3": | |
| 215, | |
| "parsing-validation@0.0.1": | |
| 182, | |
| "parsing-validation@0.0.2": | |
| 187, | |
| "parsing-validation@0.0.3": | |
| 190, | |
| "parsing-validation@0.0.4": | |
| 187, | |
| "parsing-validation@0.0.5": | |
| 288, | |
| "parsing-validation@0.1.0": | |
| 184, | |
| "parsing-validation@0.1.1": | |
| 172, | |
| "parsing-validation@0.1.2": | |
| 176, | |
| "parsing-validation@0.1.3": | |
| 117, | |
| "partial@1.0.0": | |
| 56, | |
| "partial@1.1.0": | |
| 74, | |
| "partial@1.1.1": | |
| 71, | |
| "partial@1.1.2": | |
| 127, | |
| "partial@1.2.0": | |
| 60, | |
| "partial@1.2.1": | |
| 49, | |
| "partial@2.0.0": | |
| 58, | |
| "partial@2.0.1": | |
| 71, | |
| "partial@3.0.0": | |
| 61, | |
| "partial@4.0.0": | |
| 74, | |
| "partial-isomorphisms@1.0.0": | |
| 143, | |
| "partial-order@0.0.1": | |
| 122, | |
| "path@0.1.0": | |
| -65, | |
| "path@0.2.0": | |
| -63, | |
| "path@0.2.1": | |
| -74, | |
| "path@0.2.2": | |
| -78, | |
| "path@0.2.3": | |
| -64, | |
| "path@0.2.4": | |
| -77, | |
| "path@0.2.5": | |
| -76, | |
| "path@0.2.6": | |
| -151, | |
| "path@0.2.7": | |
| -74, | |
| "pathy@0.1.0": | |
| 89, | |
| "pathy@0.1.1": | |
| 83, | |
| "pathy@0.1.2": | |
| 87, | |
| "pathy@0.1.3": | |
| 84, | |
| "pathy@0.1.4": | |
| 85, | |
| "pathy@0.2.0": | |
| 178, | |
| "pathy@0.2.1": | |
| 85, | |
| "pathy@0.2.2": | |
| 59, | |
| "pathy@0.3.0": | |
| 80, | |
| "pathy@0.3.1": | |
| 83, | |
| "pathy@0.3.2": | |
| 80, | |
| "pathy@0.3.3": | |
| 83, | |
| "pathy@1.0.0": | |
| 68, | |
| "pathy@2.0.0": | |
| 129, | |
| "pathy@3.0.0": | |
| 184, | |
| "pathy@3.0.1": | |
| 134, | |
| "pathy@3.0.2": | |
| 146, | |
| "pathy@4.0.0": | |
| 259, | |
| "pathy@4.1.0": | |
| 387, | |
| "pathy@5.0.0": | |
| 205, | |
| "pathy@6.0.0": | |
| 117, | |
| "pathy@7.0.0": | |
| 126, | |
| "pathy@7.0.1": | |
| 149, | |
| "pathy@8.0.0": | |
| 95, | |
| "pathy@8.1.0": | |
| 94, | |
| "pathy@9.0.0": | |
| 168, | |
| "paxl@0.0.1": | |
| 481, | |
| "paxl@0.0.2": | |
| 439, | |
| "payload@0.1.0": | |
| 399, | |
| "payload@0.1.1": | |
| 410, | |
| "payload@0.1.2": | |
| 411, | |
| "payload@0.1.3": | |
| 413, | |
| "payload@0.1.4": | |
| 523, | |
| "payload@0.2.0": | |
| 419, | |
| "payload@0.3.0": | |
| 415, | |
| "payload@0.3.1": | |
| 420, | |
| "payload@0.4.0": | |
| 207, | |
| "peregrine@0.0.1": | |
| 192, | |
| "periodic@1.0.0": | |
| 481, | |
| "permutations@0.1.0": | |
| 95, | |
| "permutations@0.1.1": | |
| 621, | |
| "permutations@0.2.0": | |
| 479, | |
| "permutations@0.2.1": | |
| 480, | |
| "permutations@0.2.2": | |
| 115, | |
| "pg@0.4.0": | |
| 290, | |
| "pg@0.5.0": | |
| 393, | |
| "pha@0.0.1": | |
| 254, | |
| "pha@0.0.2": | |
| 240, | |
| "pha@0.0.3": | |
| 250, | |
| "pha@0.0.4": | |
| 258, | |
| "pha@0.0.5": | |
| 264, | |
| "pha@0.0.6": | |
| 204, | |
| "pha@0.0.7": | |
| 204, | |
| "pha@0.0.8": | |
| 308, | |
| "pha@0.1.0": | |
| 199, | |
| "pha@0.1.1": | |
| 195, | |
| "pha@0.3.1": | |
| 213, | |
| "pha@0.3.3": | |
| 210, | |
| "pha@0.4.0": | |
| 448, | |
| "pha@0.5.0": | |
| 561, | |
| "pha@0.5.5": | |
| 436, | |
| "pha@0.6.1": | |
| 261, | |
| "pha@0.7.0": | |
| 271, | |
| "pha@0.7.1": | |
| 277, | |
| "pha@0.7.2": | |
| 294, | |
| "pha@0.7.3": | |
| 302, | |
| "pha@0.8.0": | |
| 168, | |
| "pha@0.8.1": | |
| 259, | |
| "pha@0.9.0": | |
| 105, | |
| "phantom@0.1.0": | |
| 40, | |
| "phantom@0.1.1": | |
| 70, | |
| "phantom@0.1.2": | |
| 63, | |
| "phantom@0.1.21": | |
| 72, | |
| "phantom@1.0.0": | |
| 94, | |
| "phantom@1.0.1": | |
| 103, | |
| "phantom@1.2.0": | |
| 259, | |
| "phantom@2.0.0": | |
| 463, | |
| "phantom@3.0.0": | |
| 314, | |
| "phantom@3.0.1": | |
| 308, | |
| "phantom@3.0.2": | |
| 311, | |
| "phantom@3.1.0": | |
| 312, | |
| "phaser@0.0.1": | |
| 227, | |
| "phaser@0.0.2": | |
| 129, | |
| "phaser@0.0.3": | |
| 118, | |
| "phaser@0.1.0": | |
| 124, | |
| "phaser@0.2.0": | |
| 127, | |
| "phaser@0.3.0": | |
| 129, | |
| "phaser@0.4.0": | |
| 158, | |
| "phaser@0.5.0": | |
| 138, | |
| "phaser@0.6.0": | |
| 211, | |
| "phinajs@0.1.0": | |
| 174, | |
| "phinajs@0.1.1": | |
| 171, | |
| "phinajs@0.1.2": | |
| 174, | |
| "phinajs@0.1.3": | |
| 186, | |
| "phinajs@0.1.4": | |
| 184, | |
| "phinajs@0.1.5": | |
| 185, | |
| "phinajs@0.1.6": | |
| 192, | |
| "phinajs@0.1.7": | |
| 301, | |
| "phinajs@0.1.8": | |
| 176, | |
| "phinajs@0.1.9": | |
| 156, | |
| "phoenix@0.1.0": | |
| 73, | |
| "phoenix@2.0.0": | |
| 226, | |
| "phoenix@2.0.1": | |
| 226, | |
| "phoenix@2.0.2": | |
| 233, | |
| "phoenix@3.0.0": | |
| 265, | |
| "phoenix@4.0.0": | |
| 304, | |
| "phylio@1.0.0": | |
| 94, | |
| "phylio@1.0.1": | |
| 93, | |
| "pino@0.1.0": | |
| 125, | |
| "pipe-op@1.0.0": | |
| 58, | |
| "pipes@4.0.0": | |
| 239, | |
| "pipes@4.0.1": | |
| 386, | |
| "pipes@4.1.0": | |
| 261, | |
| "pipes@6.0.0": | |
| 188, | |
| "pipes@7.0.0": | |
| 110, | |
| "pipes@7.0.1": | |
| 116, | |
| "pipes@8.0.0": | |
| 93, | |
| "pipes-aff@0.0.1": | |
| 434, | |
| "pipes-aff@0.0.2": | |
| 531, | |
| "pipes-aff@0.1.0": | |
| 426, | |
| "pipes-aff@0.2.0": | |
| 409, | |
| "pipes-aff@0.3.0": | |
| -494, | |
| "pipes-aff@0.4.0": | |
| -404, | |
| "pipes-aff@0.5.0": | |
| -403, | |
| "plan@1.0.0": | |
| 369, | |
| "platform@0.1.0": | |
| 78, | |
| "platform@0.2.0": | |
| 74, | |
| "platform@0.3.0": | |
| 172, | |
| "platform@0.4.0": | |
| 82, | |
| "platform@1.0.0": | |
| 52, | |
| "platform@2.0.0": | |
| 215, | |
| "platform@3.0.0": | |
| 249, | |
| "point-free@0.1.1": | |
| 61, | |
| "point-free@0.1.2": | |
| 67, | |
| "point-free@0.1.3": | |
| 67, | |
| "point-free@1.0.0": | |
| 125, | |
| "pointed@0.1.0": | |
| 104, | |
| "pointed@0.1.1": | |
| 77, | |
| "pointed-list@0.1.0": | |
| 91, | |
| "pointed-list@0.1.1": | |
| 82, | |
| "pointed-list@0.1.2": | |
| 86, | |
| "pointed-list@0.1.3": | |
| 83, | |
| "pointed-list@0.1.4": | |
| 158, | |
| "pointed-list@0.1.6": | |
| 83, | |
| "pointed-list@0.2.0": | |
| 73, | |
| "pointed-list@0.2.1": | |
| 90, | |
| "pointed-list@0.2.2": | |
| 87, | |
| "pointed-list@0.2.3": | |
| 84, | |
| "pointed-list@0.2.4": | |
| 161, | |
| "pointed-list@0.3.0": | |
| 75, | |
| "pointed-list@0.4.0": | |
| 62, | |
| "pointed-list@0.5.1": | |
| 76, | |
| "polyform@0.1.0": | |
| 320, | |
| "polyform@0.2.0": | |
| 318, | |
| "polyform@0.2.1": | |
| 309, | |
| "polyform@0.3.0": | |
| 315, | |
| "polyform@0.3.1": | |
| 433, | |
| "polyform@0.3.2": | |
| 296, | |
| "polyform@0.3.3": | |
| 293, | |
| "polyform@0.4.0": | |
| 307, | |
| "polyform@0.4.1": | |
| 315, | |
| "polyform@0.4.2": | |
| 306, | |
| "polyform@0.5.0": | |
| 314, | |
| "polyform@0.5.2": | |
| 390, | |
| "polyform@0.6.0": | |
| 293, | |
| "polyform@0.6.1": | |
| 295, | |
| "polyform@0.6.2": | |
| 313, | |
| "polyform@0.6.3": | |
| 315, | |
| "polyform@0.6.4": | |
| 393, | |
| "polyform@0.6.6": | |
| 309, | |
| "polyform@0.6.7": | |
| 354, | |
| "polyform@0.7.0": | |
| 260, | |
| "polyform@0.8.0": | |
| 246, | |
| "polyform@0.8.2": | |
| 254, | |
| "polyform@0.9.0": | |
| 114, | |
| "polyform-validators@0.0.2": | |
| 464, | |
| "polyform-validators@0.0.3": | |
| 555, | |
| "polyform-validators@0.0.4": | |
| 437, | |
| "polyform-validators@0.0.5": | |
| 439, | |
| "polyform-validators@0.0.6": | |
| 458, | |
| "polyform-validators@0.1.0": | |
| 456, | |
| "polymorphic-vectors@1.0.0": | |
| 71, | |
| "polymorphic-vectors@1.0.1": | |
| 123, | |
| "polymorphic-vectors@1.1.0": | |
| 73, | |
| "polymorphic-vectors@1.1.1": | |
| 67, | |
| "polymorphic-vectors@1.1.2": | |
| 76, | |
| "polymorphic-vectors@2.0.0": | |
| 75, | |
| "polymorphic-vectors@2.0.1": | |
| 150, | |
| "polymorphic-vectors@3.0.0": | |
| 83, | |
| "polymorphic-vectors@4.0.0": | |
| 87, | |
| "polynomials@1.0.0": | |
| 160, | |
| "polynomials@1.0.1": | |
| 160, | |
| "posix-types@0.1.0": | |
| 60, | |
| "posix-types@0.1.1": | |
| 75, | |
| "posix-types@1.0.0": | |
| 65, | |
| "posix-types@2.0.0": | |
| 123, | |
| "posix-types@3.0.0": | |
| 79, | |
| "posix-types@4.0.0": | |
| 44, | |
| "posix-types@5.0.0": | |
| 60, | |
| "posix-types@6.0.0": | |
| 70, | |
| "postgresql-client@0.0.1": | |
| -200, | |
| "postgresql-client@0.0.2": | |
| -198, | |
| "postgresql-client@0.0.3": | |
| -197, | |
| "postgresql-client@0.0.4": | |
| -318, | |
| "postgresql-client@0.0.5": | |
| -186, | |
| "postgresql-client@0.0.6": | |
| -180, | |
| "postgresql-client@0.0.7": | |
| -189, | |
| "postgresql-client@0.0.8": | |
| -201, | |
| "postgresql-client@0.0.9": | |
| -195, | |
| "postgresql-client@0.0.10": | |
| -220, | |
| "postgresql-client@0.0.11": | |
| -233, | |
| "postgresql-client@0.0.12": | |
| -325, | |
| "postgresql-client@0.0.13": | |
| -202, | |
| "postgresql-client@0.0.14": | |
| -199, | |
| "postgresql-client@0.0.15": | |
| -220, | |
| "postgresql-client@0.0.16": | |
| -216, | |
| "postgresql-client@0.0.17": | |
| -217, | |
| "postgresql-client@0.0.18": | |
| -314, | |
| "postgresql-client@0.0.19": | |
| -212, | |
| "postgresql-client@0.0.20": | |
| -205, | |
| "postgresql-client@0.0.21": | |
| -214, | |
| "postgresql-client@0.0.22": | |
| -226, | |
| "postgresql-client@0.0.23": | |
| -225, | |
| "postgresql-client@0.0.24": | |
| -227, | |
| "postgresql-client@0.0.25": | |
| -228, | |
| "postgresql-client@0.0.26": | |
| -340, | |
| "postgresql-client@0.0.27": | |
| 470, | |
| "postgresql-client@1.0.0": | |
| 454, | |
| "postgresql-client@2.0.0": | |
| 521, | |
| "postgresql-client@2.1.0": | |
| 524, | |
| "postgresql-client@2.2.0": | |
| 581, | |
| "postgresql-client@2.3.0": | |
| 705, | |
| "postgresql-client@2.4.0": | |
| 367, | |
| "postgresql-client@2.4.1": | |
| 362, | |
| "postgresql-client@2.4.2": | |
| 377, | |
| "postgresql-client@2.4.3": | |
| 385, | |
| "postgresql-client@2.4.4": | |
| 393, | |
| "postgresql-client@3.0.0": | |
| 376, | |
| "postgresql-client@3.0.1": | |
| 601, | |
| "postgresql-client@3.0.2": | |
| 462, | |
| "postgresql-client@3.0.3": | |
| 446, | |
| "postgresql-client@3.1.0": | |
| 470, | |
| "postgresql-client@3.1.1": | |
| 463, | |
| "pouchdb@0.1.1": | |
| 71, | |
| "pprint@0.1.0": | |
| 73, | |
| "pprint@1.0.0": | |
| 134, | |
| "pprint@1.0.1": | |
| 68, | |
| "pprint@1.0.2": | |
| 59, | |
| "pprint@2.0.0": | |
| 111, | |
| "pprint@3.0.0": | |
| 90, | |
| "pprint@4.0.0": | |
| 155, | |
| "pprint@5.0.0": | |
| 135, | |
| "pqueue@0.1.0": | |
| 150, | |
| "pqueue@0.1.1": | |
| 70, | |
| "pqueue@0.1.2": | |
| 64, | |
| "pqueue@0.1.3": | |
| 83, | |
| "pqueue@0.2.0": | |
| 85, | |
| "pqueue@0.3.0": | |
| 79, | |
| "pqueue@0.4.0": | |
| 319, | |
| "pqueue@0.4.1": | |
| 204, | |
| "pqueue@0.4.2": | |
| 140, | |
| "pqueue@1.0.0": | |
| 401, | |
| "pqueue@2.0.0": | |
| 112, | |
| "pray@0.0.1": | |
| 74, | |
| "precise@1.0.0": | |
| 221, | |
| "precise@1.0.1": | |
| 222, | |
| "precise@1.1.0": | |
| 353, | |
| "precise@1.2.0": | |
| 57, | |
| "precise@1.2.1": | |
| 56, | |
| "precise@1.3.0": | |
| 83, | |
| "precise@1.3.1": | |
| 81, | |
| "precise@1.3.2": | |
| 82, | |
| "precise@1.4.0": | |
| 82, | |
| "precise@2.0.0": | |
| 431, | |
| "precise@2.0.1": | |
| 61, | |
| "precise@3.0.0": | |
| 143, | |
| "precise@3.0.1": | |
| 154, | |
| "precise@4.0.0": | |
| 129, | |
| "precise@5.0.0": | |
| 100, | |
| "precise@5.1.0": | |
| 101, | |
| "precise@6.0.0": | |
| 91, | |
| "precise-datetime@1.0.0": | |
| 385, | |
| "precise-datetime@2.0.0": | |
| 242, | |
| "precise-datetime@2.1.0": | |
| 243, | |
| "precise-datetime@3.0.0": | |
| 249, | |
| "precise-datetime@3.1.0": | |
| 255, | |
| "precise-datetime@4.0.0": | |
| 260, | |
| "precise-datetime@4.1.0": | |
| 257, | |
| "precise-datetime@5.0.0": | |
| 310, | |
| "precise-datetime@5.0.1": | |
| 234, | |
| "precise-datetime@5.0.2": | |
| 215, | |
| "precise-datetime@5.0.3": | |
| 224, | |
| "precise-datetime@5.0.4": | |
| 236, | |
| "precise-datetime@5.1.0": | |
| 235, | |
| "precise-datetime@5.1.1": | |
| 237, | |
| "precise-datetime@6.0.0": | |
| 146, | |
| "precise-datetime@6.0.1": | |
| 242, | |
| "precise-datetime@7.0.0": | |
| 106, | |
| "prelewd@0.0.1": | |
| 419, | |
| "prelewd@0.1.0": | |
| 478, | |
| "prelude@0.1.0": | |
| 61, | |
| "prelude@0.1.1": | |
| 69, | |
| "prelude@0.1.2": | |
| 66, | |
| "prelude@0.1.3": | |
| 111, | |
| "prelude@0.1.4": | |
| 44, | |
| "prelude@0.1.5": | |
| 49, | |
| "prelude@1.0.0": | |
| 65, | |
| "prelude@1.0.1": | |
| 73, | |
| "prelude@1.1.0": | |
| 57, | |
| "prelude@2.0.0": | |
| 127, | |
| "prelude@2.1.0": | |
| 47, | |
| "prelude@2.2.0": | |
| 56, | |
| "prelude@2.3.0": | |
| 69, | |
| "prelude@2.4.0": | |
| 74, | |
| "prelude@2.5.0": | |
| 61, | |
| "prelude@3.0.0": | |
| 76, | |
| "prelude@3.1.0": | |
| 119, | |
| "prelude@3.1.1": | |
| 49, | |
| "prelude@3.2.0": | |
| 54, | |
| "prelude@3.3.0": | |
| 68, | |
| "prelude@4.0.0": | |
| 69, | |
| "prelude@4.0.1": | |
| 71, | |
| "prelude@4.1.0": | |
| 56, | |
| "prelude@4.1.1": | |
| 173, | |
| "prelude@5.0.0": | |
| 50, | |
| "prelude@5.0.1": | |
| 50, | |
| "prelude@6.0.0": | |
| 58, | |
| "prelude@6.0.1": | |
| 69, | |
| "presto@0.1.0": | |
| -535, | |
| "presto@0.2.0": | |
| -487, | |
| "presto@0.2.2": | |
| -571, | |
| "presto@0.2.3": | |
| -479, | |
| "presto@0.3.0": | |
| 295, | |
| "presto@0.4.0": | |
| 346, | |
| "presto@0.4.1": | |
| 299, | |
| "prettier@0.0.1": | |
| 61, | |
| "prettier@0.0.2": | |
| 74, | |
| "prettier@0.1.0": | |
| 65, | |
| "prettier@0.2.0": | |
| 142, | |
| "prettier@0.3.0": | |
| 51, | |
| "prettier-printer@1.0.0": | |
| -399, | |
| "prettier-printer@1.0.1": | |
| -363, | |
| "prettier-printer@1.1.0": | |
| -362, | |
| "prettier-printer@1.2.0": | |
| -363, | |
| "prettier-printer@2.0.0": | |
| 90, | |
| "prettier-printer@2.0.1": | |
| 165, | |
| "prettier-printer@3.0.0": | |
| 85, | |
| "pretty-logs@0.1.0": | |
| 44, | |
| "prng@0.0.1": | |
| 104, | |
| "prng@0.1.0": | |
| 99, | |
| "probability@0.0.0": | |
| 74, | |
| "probability@0.0.1": | |
| 154, | |
| "probability@0.0.2": | |
| 158, | |
| "probability@1.0.0": | |
| 137, | |
| "probability@2.0.0": | |
| 221, | |
| "probability@3.0.0": | |
| 214, | |
| "probability@3.1.0": | |
| 219, | |
| "probability@3.1.1": | |
| 308, | |
| "probability@3.1.2": | |
| 206, | |
| "probability@4.0.0": | |
| 188, | |
| "probability@4.0.1": | |
| 200, | |
| "probability@4.0.2": | |
| 202, | |
| "probability@4.1.0": | |
| 203, | |
| "probability@5.0.0": | |
| 175, | |
| "probability@5.1.0": | |
| 173, | |
| "profunctor@0.0.1": | |
| 121, | |
| "profunctor@0.0.2": | |
| 76, | |
| "profunctor@0.1.0": | |
| 61, | |
| "profunctor@0.2.0": | |
| 83, | |
| "profunctor@0.2.1": | |
| 72, | |
| "profunctor@0.3.0": | |
| 76, | |
| "profunctor@0.3.1": | |
| 80, | |
| "profunctor@0.3.2": | |
| 70, | |
| "profunctor@1.0.0": | |
| 108, | |
| "profunctor@2.0.0": | |
| 78, | |
| "profunctor@3.0.0": | |
| 84, | |
| "profunctor@3.1.0": | |
| 92, | |
| "profunctor@3.2.0": | |
| 86, | |
| "profunctor@4.0.0": | |
| 174, | |
| "profunctor@4.1.0": | |
| 69, | |
| "profunctor@5.0.0": | |
| 54, | |
| "profunctor@6.0.0": | |
| 57, | |
| "profunctor-lenses@0.1.0": | |
| 82, | |
| "profunctor-lenses@0.2.0": | |
| 90, | |
| "profunctor-lenses@0.3.0": | |
| 87, | |
| "profunctor-lenses@0.3.1": | |
| 109, | |
| "profunctor-lenses@0.3.2": | |
| 235, | |
| "profunctor-lenses@0.3.3": | |
| 97, | |
| "profunctor-lenses@0.3.4": | |
| 91, | |
| "profunctor-lenses@0.3.5": | |
| 100, | |
| "profunctor-lenses@0.4.0": | |
| 92, | |
| "profunctor-lenses@0.4.1": | |
| 92, | |
| "profunctor-lenses@0.4.2": | |
| -94, | |
| "profunctor-lenses@0.5.0": | |
| -178, | |
| "profunctor-lenses@0.5.1": | |
| -82, | |
| "profunctor-lenses@0.5.2": | |
| -77, | |
| "profunctor-lenses@0.5.3": | |
| -81, | |
| "profunctor-lenses@0.5.4": | |
| -93, | |
| "profunctor-lenses@1.0.0": | |
| 78, | |
| "profunctor-lenses@2.0.0": | |
| 252, | |
| "profunctor-lenses@2.1.0": | |
| 239, | |
| "profunctor-lenses@2.2.0": | |
| 368, | |
| "profunctor-lenses@2.3.0": | |
| -198, | |
| "profunctor-lenses@2.4.0": | |
| 214, | |
| "profunctor-lenses@2.5.0": | |
| 222, | |
| "profunctor-lenses@2.6.0": | |
| -202, | |
| "profunctor-lenses@3.0.0": | |
| 294, | |
| "profunctor-lenses@3.1.0": | |
| 332, | |
| "profunctor-lenses@3.2.0": | |
| 299, | |
| "profunctor-lenses@3.3.0": | |
| 416, | |
| "profunctor-lenses@3.4.0": | |
| 324, | |
| "profunctor-lenses@3.5.0": | |
| 321, | |
| "profunctor-lenses@3.6.0": | |
| 333, | |
| "profunctor-lenses@3.6.1": | |
| 328, | |
| "profunctor-lenses@3.7.0": | |
| 318, | |
| "profunctor-lenses@3.8.0": | |
| 411, | |
| "profunctor-lenses@4.0.0": | |
| 167, | |
| "profunctor-lenses@5.0.0": | |
| 157, | |
| "profunctor-lenses@6.0.0": | |
| 180, | |
| "profunctor-lenses@6.1.0": | |
| 179, | |
| "profunctor-lenses@6.1.1": | |
| 283, | |
| "profunctor-lenses@6.2.0": | |
| 178, | |
| "profunctor-lenses@6.3.0": | |
| 165, | |
| "profunctor-lenses@7.0.0": | |
| 90, | |
| "profunctor-lenses@7.0.1": | |
| 100, | |
| "profunctor-lenses@8.0.0": | |
| 87, | |
| "projections@0.0.2": | |
| 56, | |
| "projections@0.1.0": | |
| 76, | |
| "promises@0.1.0": | |
| 260, | |
| "promises@0.2.0": | |
| 130, | |
| "promises@1.0.0": | |
| 289, | |
| "promises@1.0.1": | |
| 287, | |
| "promises@2.0.0": | |
| 295, | |
| "promises@3.0.0": | |
| 144, | |
| "promises@3.1.0": | |
| 149, | |
| "promises@3.1.1": | |
| 146, | |
| "propel@0.1.0": | |
| 614, | |
| "properties@0.1.0": | |
| 45, | |
| "properties@0.2.0": | |
| 53, | |
| "proportion@0.1.0": | |
| 101, | |
| "proportion@0.2.0": | |
| 99, | |
| "proportion@0.3.0": | |
| 101, | |
| "protobuf@0.9.0": | |
| 55, | |
| "protobuf@0.9.1": | |
| 152, | |
| "protobuf@0.9.2": | |
| 271, | |
| "protobuf@0.9.3": | |
| 242, | |
| "protobuf@1.0.0": | |
| 239, | |
| "protobuf@1.1.0": | |
| 244, | |
| "protobuf@1.1.1": | |
| 245, | |
| "protobuf@1.2.0": | |
| 251, | |
| "protobuf@1.3.0": | |
| 338, | |
| "protobuf@1.4.0": | |
| 229, | |
| "protobuf@1.5.0": | |
| 222, | |
| "protobuf@1.6.0": | |
| 240, | |
| "protobuf@1.7.0": | |
| 246, | |
| "protobuf@1.7.1": | |
| 242, | |
| "protobuf@1.8.0": | |
| 372, | |
| "protobuf@2.0.0": | |
| -224, | |
| "protobuf@2.1.0": | |
| -212, | |
| "protobuf@2.1.1": | |
| -221, | |
| "protobuf@2.1.2": | |
| -235, | |
| "protobuf@3.0.0": | |
| 119, | |
| "protobuf@4.0.0": | |
| 119, | |
| "proxy@0.1.0": | |
| 57, | |
| "proxy@1.0.0": | |
| 127, | |
| "proxy@2.0.0": | |
| 45, | |
| "proxy@2.1.0": | |
| 51, | |
| "proxy@3.0.0": | |
| 58, | |
| "proxy@3.0.1": | |
| 71, | |
| "proxy@3.0.2": | |
| 68, | |
| "proxying@0.1.0": | |
| -144, | |
| "proxying@1.0.0": | |
| 182, | |
| "proxying@1.0.1": | |
| 85, | |
| "proxying@1.1.0": | |
| 84, | |
| "ps-cst@1.2.0": | |
| 310, | |
| "psa-utils@1.0.0": | |
| 75, | |
| "psa-utils@1.0.1": | |
| 109, | |
| "psa-utils@2.0.0": | |
| 278, | |
| "psa-utils@2.1.0": | |
| 233, | |
| "psa-utils@3.0.0": | |
| 305, | |
| "psa-utils@4.0.0": | |
| 314, | |
| "psa-utils@5.0.0": | |
| 238, | |
| "psa-utils@5.0.1": | |
| 241, | |
| "psa-utils@5.1.0": | |
| 242, | |
| "psa-utils@6.0.0": | |
| 336, | |
| "psa-utils@7.0.0": | |
| 215, | |
| "psa-utils@8.0.0": | |
| 108, | |
| "psc-ide@0.1.2": | |
| 112, | |
| "psc-ide@1.2.0": | |
| 125, | |
| "psc-ide@2.0.0": | |
| 121, | |
| "psc-ide@2.1.0": | |
| 130, | |
| "psc-ide@3.0.0": | |
| 131, | |
| "psc-ide@3.0.1": | |
| 214, | |
| "psc-ide@4.0.0": | |
| 92, | |
| "psc-ide@4.0.1": | |
| 81, | |
| "psc-ide@5.0.0": | |
| 89, | |
| "psc-ide@5.0.1": | |
| 97, | |
| "psc-ide@5.0.2": | |
| 96, | |
| "psc-ide@5.0.3": | |
| -280, | |
| "psc-ide@5.0.4": | |
| -277, | |
| "psc-ide@6.0.0": | |
| -387, | |
| "psc-ide@7.0.0": | |
| 711, | |
| "psc-ide@7.0.1": | |
| 622, | |
| "psc-ide@8.0.0": | |
| 734, | |
| "psc-ide@8.0.1": | |
| 737, | |
| "psc-ide@9.0.0": | |
| 874, | |
| "psc-ide@9.0.1": | |
| 720, | |
| "psc-ide@10.0.0": | |
| 716, | |
| "psc-ide@10.1.0": | |
| 740, | |
| "psc-ide@11.0.0": | |
| 742, | |
| "psc-ide@11.1.0": | |
| 741, | |
| "psc-ide@12.0.0": | |
| 868, | |
| "psc-ide@13.0.0": | |
| 713, | |
| "psc-ide@13.0.1": | |
| 345, | |
| "psc-ide@14.0.0": | |
| 359, | |
| "psc-ide@15.0.0": | |
| 418, | |
| "psc-ide@15.0.1": | |
| 418, | |
| "psc-ide@16.0.0": | |
| 409, | |
| "psc-ide@17.0.0": | |
| 491, | |
| "psc-ide@18.0.0": | |
| 149, | |
| "psc-ide@19.0.0": | |
| 126, | |
| "psci-support@1.0.0": | |
| 53, | |
| "psci-support@2.0.0": | |
| 72, | |
| "psci-support@3.0.0": | |
| 77, | |
| "psci-support@4.0.0": | |
| 124, | |
| "psci-support@5.0.0": | |
| 46, | |
| "psci-support@6.0.0": | |
| 52, | |
| "pseudo-random@0.1.0": | |
| 135, | |
| "pseudo-random@0.2.0": | |
| 110, | |
| "pseudo-random@0.2.1": | |
| 105, | |
| "pseudo-random@0.2.2": | |
| 178, | |
| "pshendry-halogen@0.1.0": | |
| -216, | |
| "pshendry-halogen@0.1.1": | |
| -200, | |
| "pshendry-halogen@0.1.2": | |
| -201, | |
| "pshendry-halogen@0.1.3": | |
| -221, | |
| "pshendry-halogen@0.1.4": | |
| -209, | |
| "pshendry-halogen@0.1.5": | |
| -213, | |
| "pshendry-halogen@0.1.6": | |
| -215, | |
| "pshendry-halogen@0.1.7": | |
| -359, | |
| "pshendry-halogen@0.1.8": | |
| -198, | |
| "pshendry-halogen@0.1.9": | |
| -197, | |
| "pshendry-halogen@0.1.10": | |
| -207, | |
| "pshendry-halogen@0.1.11": | |
| -216, | |
| "pshendry-halogen@0.1.12": | |
| -216, | |
| "pshendry-halogen@0.1.13": | |
| -220, | |
| "pshendry-halogen@0.1.14": | |
| -332, | |
| "pshendry-halogen@0.2.0": | |
| -532, | |
| "puchitomato@0.1.0": | |
| 210, | |
| "pure-css@0.0.0": | |
| 54, | |
| "pure-css@0.0.1": | |
| 72, | |
| "pure-style@0.1.0": | |
| 142, | |
| "pure-style@0.1.1": | |
| 137, | |
| "pure-style@1.0.0": | |
| 346, | |
| "pure-style@1.1.0": | |
| 158, | |
| "pure-style@1.2.0": | |
| 164, | |
| "pure-style@2.0.0": | |
| 120, | |
| "pure-style@2.0.1": | |
| 125, | |
| "pure-style@3.0.0": | |
| 128, | |
| "pure-style@4.0.0": | |
| 115, | |
| "pure-style@4.0.1": | |
| 184, | |
| "purescript-compiler-backend-utilities@0.0.1": | |
| 297, | |
| "purversion@0.0.4": | |
| 296, | |
| "purversion@0.0.5": | |
| 312, | |
| "purversion@0.0.6": | |
| 317, | |
| "purview@1.0.0": | |
| 744, | |
| "purview@1.1.0": | |
| 831, | |
| "pux@0.0.1": | |
| 88, | |
| "pux@0.1.0": | |
| 89, | |
| "pux@0.2.0": | |
| 103, | |
| "pux@0.3.0": | |
| 85, | |
| "pux@1.0.0": | |
| 116, | |
| "pux@2.0.0": | |
| 185, | |
| "pux@2.0.1": | |
| 106, | |
| "pux@2.0.2": | |
| 102, | |
| "pux@3.0.0": | |
| 118, | |
| "pux@3.1.0": | |
| 101, | |
| "pux@4.0.0": | |
| 178, | |
| "pux@4.0.1": | |
| 91, | |
| "pux@4.1.0": | |
| 86, | |
| "pux@5.0.0": | |
| 69, | |
| "pux@5.0.1": | |
| 85, | |
| "pux@5.0.2": | |
| 84, | |
| "pux@5.0.3": | |
| 86, | |
| "pux@6.0.0": | |
| -219, | |
| "pux@6.0.1": | |
| -279, | |
| "pux@7.0.0": | |
| 550, | |
| "pux@7.1.0": | |
| 527, | |
| "pux@7.2.0": | |
| 542, | |
| "pux@8.0.0": | |
| -464, | |
| "pux@8.1.0": | |
| -464, | |
| "pux@8.2.0": | |
| -466, | |
| "pux@8.3.0": | |
| -590, | |
| "pux@8.4.0": | |
| -446, | |
| "pux@8.5.0": | |
| -451, | |
| "pux@8.6.0": | |
| -456, | |
| "pux@8.7.0": | |
| -460, | |
| "pux@8.8.0": | |
| -464, | |
| "pux@8.9.0": | |
| -466, | |
| "pux@9.0.0": | |
| 656, | |
| "pux@9.1.0": | |
| 532, | |
| "pux@9.2.0": | |
| 527, | |
| "pux@9.3.0": | |
| 548, | |
| "pux@10.0.0": | |
| 655, | |
| "pux@11.0.0": | |
| 531, | |
| "pux@12.0.0": | |
| 425, | |
| "pux@13.0.0": | |
| 307, | |
| "pux-clappr@0.1.0": | |
| 707, | |
| "pux-clappr@0.2.0": | |
| 716, | |
| "pux-clappr@0.2.1": | |
| 775, | |
| "pux-css@1.0.0": | |
| -227, | |
| "pux-devtool@1.0.0": | |
| 110, | |
| "pux-devtool@1.1.0": | |
| 101, | |
| "pux-devtool@2.0.0": | |
| -106, | |
| "pux-devtool@2.0.1": | |
| -118, | |
| "pux-devtool@2.0.2": | |
| -115, | |
| "pux-devtool@2.0.3": | |
| -119, | |
| "pux-devtool@3.0.0": | |
| -94, | |
| "pux-devtool@3.0.1": | |
| -200, | |
| "pux-devtool@4.0.0": | |
| -683, | |
| "pux-devtool@4.1.0": | |
| -648, | |
| "pux-document-title@1.0.0": | |
| -251, | |
| "pux-echarts@0.1.0": | |
| 1061, | |
| "pux-echarts@1.0.0": | |
| 874, | |
| "pux-form@1.0.0": | |
| 1212, | |
| "pux-form@1.0.1": | |
| 1061, | |
| "pux-form@2.0.0": | |
| 1043, | |
| "pux-form@2.1.0": | |
| 657, | |
| "pux-form@2.2.0": | |
| 308, | |
| "pux-redux@0.2.0": | |
| 630, | |
| "pux-redux@0.2.1": | |
| 623, | |
| "pux-redux@0.2.2": | |
| 726, | |
| "pux-smolder-dom@1.0.0": | |
| 725, | |
| "pux-spectacle@1.0.1": | |
| 75, | |
| "pux-spectacle@1.1.0": | |
| 91, | |
| "pux-spectacle@1.2.0": | |
| 88, | |
| "pux-spectacle@2.0.0": | |
| 922, | |
| "pux-spectacle-codeslide@1.0.0": | |
| 83, | |
| "pux-spectacle-codeslide@2.0.0": | |
| 887, | |
| "puxing-bob@0.0.3": | |
| -642, | |
| "puxing-bob@0.1.0": | |
| -649, | |
| "pwned-passwords@1.0.0": | |
| 328, | |
| "pwned-passwords@2.0.0": | |
| 168, | |
| "qieyun@0.1.0": | |
| 182, | |
| "qieyun@0.2.0": | |
| 46, | |
| "qieyun@0.3.0": | |
| 55, | |
| "qieyun@0.4.0": | |
| 58, | |
| "qieyun@0.5.0": | |
| 77, | |
| "qrcode@0.0.0": | |
| -302, | |
| "qrcode@0.0.1": | |
| -264, | |
| "qrcode@0.0.2": | |
| -266, | |
| "qrcode-js@0.1.0": | |
| 150, | |
| "qrcode-js@0.2.0": | |
| 106, | |
| "qrcode-js@1.0.0": | |
| -228, | |
| "qrcode-js@2.0.0": | |
| 496, | |
| "qrcode-js-halogen@0.1.0": | |
| 105, | |
| "qrcode-js-halogen@1.0.0": | |
| -271, | |
| "qrcode-js-halogen@1.1.0": | |
| -271, | |
| "qrcode-js-halogen@2.0.0": | |
| -838, | |
| "qrcode-js-halogen@2.0.1": | |
| -696, | |
| "qrcode-js-halogen@3.0.0": | |
| -655, | |
| "qualified-do@1.0.0": | |
| 72, | |
| "qualified-do@2.0.0": | |
| 90, | |
| "qualified-do@2.1.0": | |
| 81, | |
| "qualified-do@2.2.0": | |
| 89, | |
| "quantities@1.0.0": | |
| 64, | |
| "quantities@1.1.0": | |
| 153, | |
| "quantities@2.0.0": | |
| 155, | |
| "quantities@2.1.0": | |
| 128, | |
| "quantities@2.2.0": | |
| 151, | |
| "quantities@3.0.0": | |
| 138, | |
| "quantities@3.1.0": | |
| 141, | |
| "quantities@3.2.0": | |
| 233, | |
| "quantities@3.3.0": | |
| 139, | |
| "quantities@3.4.0": | |
| 124, | |
| "quantities@3.5.0": | |
| 128, | |
| "quantities@3.5.1": | |
| 112, | |
| "quantities@3.5.2": | |
| 113, | |
| "quantities@3.5.3": | |
| 113, | |
| "quantities@3.5.4": | |
| 114, | |
| "quantities@3.6.0": | |
| 188, | |
| "quantities@4.0.0": | |
| 97, | |
| "quantities@4.0.1": | |
| 102, | |
| "quantities@4.1.0": | |
| 93, | |
| "quantities@4.1.1": | |
| 111, | |
| "quantities@5.0.0": | |
| 315, | |
| "quantities@5.0.1": | |
| 310, | |
| "quantities@5.0.2": | |
| 304, | |
| "quantities@5.0.3": | |
| 401, | |
| "quantities@5.1.0": | |
| 255, | |
| "quantities@5.2.0": | |
| 250, | |
| "quantities@6.0.0": | |
| 254, | |
| "quantities@6.1.0": | |
| 263, | |
| "quantities@6.2.0": | |
| 412, | |
| "quantities@6.3.0": | |
| 415, | |
| "quantities@6.4.0": | |
| 411, | |
| "quantities@6.4.1": | |
| 527, | |
| "quantities@7.0.0": | |
| 394, | |
| "quantities@7.1.0": | |
| 384, | |
| "quantities@7.2.0": | |
| 402, | |
| "quantities@8.0.0": | |
| 162, | |
| "quantities@8.0.1": | |
| 168, | |
| "quantities@8.0.2": | |
| 271, | |
| "quantities@8.1.0": | |
| 152, | |
| "quantities@8.1.1": | |
| 149, | |
| "quantities@8.2.0": | |
| 151, | |
| "quantities@8.3.0": | |
| 162, | |
| "quantities@8.3.1": | |
| 165, | |
| "quantities@9.0.0": | |
| 167, | |
| "quantities@10.0.0": | |
| 259, | |
| "quantities@11.0.0": | |
| 199, | |
| "quantities@12.0.0": | |
| -104, | |
| "quantities@12.0.1": | |
| 128, | |
| "quantities@12.1.0": | |
| 97, | |
| "quasar@1.0.0": | |
| -143, | |
| "quasar@1.1.0": | |
| -142, | |
| "quasar@1.2.0": | |
| -142, | |
| "quasar@2.0.0": | |
| 256, | |
| "quasar@3.0.0": | |
| -236, | |
| "quasar@4.0.0": | |
| -220, | |
| "quasar@5.0.0": | |
| -227, | |
| "quasar@6.0.0": | |
| -237, | |
| "quasar@7.0.0": | |
| -237, | |
| "quasar@8.0.0": | |
| -238, | |
| "quasar@9.0.0": | |
| -235, | |
| "quasar@10.0.0": | |
| -342, | |
| "quasar@11.0.0": | |
| -833, | |
| "quasar@12.0.0": | |
| -829, | |
| "quasar@13.0.0": | |
| -843, | |
| "quasar@14.0.0": | |
| -944, | |
| "quasar@14.0.1": | |
| -826, | |
| "quasar@15.0.0": | |
| -792, | |
| "quasar@16.0.0": | |
| -832, | |
| "quasar@17.0.0": | |
| -820, | |
| "quasar@18.0.0": | |
| -820, | |
| "quasar@19.0.0": | |
| -932, | |
| "quasar@20.0.0": | |
| -791, | |
| "quasar@21.0.0": | |
| -788, | |
| "quasar@22.0.0": | |
| 1361, | |
| "quasar@23.0.0": | |
| 1353, | |
| "quasar@24.0.0": | |
| 1469, | |
| "quasar@25.0.0": | |
| 1325, | |
| "quasar@25.0.1": | |
| 1334, | |
| "quasar@26.0.0": | |
| 1411, | |
| "quasar@27.0.0": | |
| 1350, | |
| "quasar@28.0.0": | |
| 1468, | |
| "quasar@29.0.0": | |
| 1292, | |
| "quasar@30.0.0": | |
| 1302, | |
| "quasar@31.0.0": | |
| 1284, | |
| "quasar@31.1.0": | |
| 1294, | |
| "quasar@32.0.0": | |
| 1416, | |
| "quasar@33.0.0": | |
| 1252, | |
| "quasar@34.0.0": | |
| 1258, | |
| "quasar@35.0.0": | |
| 1284, | |
| "quasar@35.0.1": | |
| 1292, | |
| "quasar@36.0.0": | |
| 1400, | |
| "quasar@37.0.0": | |
| 1280, | |
| "quasar@38.0.0": | |
| 1199, | |
| "quasar@38.0.1": | |
| 1223, | |
| "quasar@38.0.2": | |
| 1214, | |
| "quasar@38.0.3": | |
| 1346, | |
| "quasar@38.0.4": | |
| 1205, | |
| "quasar@38.0.5": | |
| 1181, | |
| "quasar@38.0.6": | |
| 1204, | |
| "quasar@38.1.0": | |
| 1208, | |
| "quasar@38.2.0": | |
| 1305, | |
| "quasar@39.0.0": | |
| 1361, | |
| "quasar@40.0.0": | |
| 1304, | |
| "quasar@40.1.0": | |
| 1338, | |
| "quasar@40.1.1": | |
| 1336, | |
| "quasar@40.1.2": | |
| 1439, | |
| "quasar@41.0.0": | |
| 1319, | |
| "quasar@41.0.1": | |
| 1307, | |
| "quasar@42.0.0": | |
| 1437, | |
| "quasar@42.0.1": | |
| 1300, | |
| "quasar@43.0.0": | |
| 1204, | |
| "quasar@43.1.0": | |
| 1228, | |
| "quasar@43.1.1": | |
| 1365, | |
| "quasar@44.0.0": | |
| 1184, | |
| "quasar@45.0.0": | |
| 1145, | |
| "quaternions@0.1.0": | |
| -55, | |
| "quaternions@0.1.1": | |
| -85, | |
| "quaternions@1.0.0": | |
| 644, | |
| "quaternions@2.0.0": | |
| 733, | |
| "quaternions@2.1.0": | |
| 660, | |
| "quaternions@3.0.0": | |
| 42, | |
| "quaternions@3.0.1": | |
| 65, | |
| "quaternions@4.0.0": | |
| 66, | |
| "query-params@0.0.1": | |
| 248, | |
| "query-params@1.0.0": | |
| 347, | |
| "query-params@1.0.1": | |
| 238, | |
| "query-params@1.0.2": | |
| 230, | |
| "query-params@2.0.0": | |
| -312, | |
| "querydsl@0.1.0": | |
| 139, | |
| "querydsl@0.1.1": | |
| 247, | |
| "querydsl@0.1.2": | |
| 237, | |
| "querydsl@0.2.0": | |
| 327, | |
| "querydsl@0.3.0": | |
| 453, | |
| "querydsl@0.5.0": | |
| 340, | |
| "querydsl@0.6.0": | |
| 342, | |
| "querydsl@0.7.0": | |
| 378, | |
| "querydsl@0.7.1": | |
| 339, | |
| "querydsl@0.7.2": | |
| 394, | |
| "querydsl@0.8.0": | |
| 437, | |
| "querydsl@0.9.0": | |
| 411, | |
| "querydsl@0.9.1": | |
| 381, | |
| "querydsl@0.9.5": | |
| 385, | |
| "querydsl@0.9.6": | |
| 406, | |
| "querydsl@0.10.0": | |
| 303, | |
| "querydsl@0.10.1": | |
| 306, | |
| "queue@0.0.1": | |
| 551, | |
| "queue@0.0.2": | |
| 423, | |
| "queue@0.1.0": | |
| 417, | |
| "queue@0.2.0": | |
| 415, | |
| "queue@0.3.0": | |
| 431, | |
| "queue@0.4.0": | |
| 433, | |
| "queue@0.5.0": | |
| 429, | |
| "queue@0.6.0": | |
| 527, | |
| "queue@0.7.0": | |
| 414, | |
| "queue@0.8.0": | |
| 405, | |
| "queue@1.0.0": | |
| 444, | |
| "queue@1.1.0": | |
| 453, | |
| "queue@1.1.1": | |
| 450, | |
| "queue@2.0.0": | |
| 452, | |
| "queue@2.0.1": | |
| 561, | |
| "queue@3.0.0": | |
| 446, | |
| "queue@4.0.0": | |
| 435, | |
| "queue@4.0.1": | |
| 439, | |
| "queue@4.0.2": | |
| 458, | |
| "queue@4.1.0": | |
| 485, | |
| "queue@4.2.0": | |
| 463, | |
| "queue@5.0.0": | |
| 459, | |
| "queue@6.0.0": | |
| 559, | |
| "queue@7.0.0": | |
| 205, | |
| "queue@7.1.0": | |
| 204, | |
| "queue@7.1.1": | |
| 222, | |
| "queue@7.1.2": | |
| 220, | |
| "queue@7.1.3": | |
| 304, | |
| "queue@8.0.0": | |
| 250, | |
| "queue@8.0.1": | |
| 225, | |
| "queue@8.0.2": | |
| 239, | |
| "quick-format@0.0.1": | |
| 153, | |
| "quick-format@0.0.2": | |
| 154, | |
| "quickcheck@0.2.1": | |
| -136, | |
| "quickcheck@0.2.2": | |
| -71, | |
| "quickcheck@0.3.0": | |
| -50, | |
| "quickcheck@0.3.1": | |
| -69, | |
| "quickcheck@0.3.2": | |
| 71, | |
| "quickcheck@0.4.0": | |
| 71, | |
| "quickcheck@0.5.0": | |
| 164, | |
| "quickcheck@0.5.1": | |
| 71, | |
| "quickcheck@0.5.2": | |
| 62, | |
| "quickcheck@0.6.0": | |
| 75, | |
| "quickcheck@0.7.0": | |
| 83, | |
| "quickcheck@0.8.0": | |
| 79, | |
| "quickcheck@0.9.0": | |
| 83, | |
| "quickcheck@0.10.0": | |
| 158, | |
| "quickcheck@0.10.1": | |
| 87, | |
| "quickcheck@0.11.0": | |
| 62, | |
| "quickcheck@0.12.0": | |
| 72, | |
| "quickcheck@0.12.1": | |
| 84, | |
| "quickcheck@0.12.2": | |
| 80, | |
| "quickcheck@1.0.0": | |
| 74, | |
| "quickcheck@2.0.0": | |
| 128, | |
| "quickcheck@3.0.0": | |
| 277, | |
| "quickcheck@3.1.0": | |
| 144, | |
| "quickcheck@3.1.1": | |
| 137, | |
| "quickcheck@4.0.0": | |
| 169, | |
| "quickcheck@4.1.0": | |
| 180, | |
| "quickcheck@4.2.0": | |
| 184, | |
| "quickcheck@4.3.0": | |
| 188, | |
| "quickcheck@4.4.0": | |
| 211, | |
| "quickcheck@4.5.0": | |
| 326, | |
| "quickcheck@4.6.0": | |
| 150, | |
| "quickcheck@4.6.1": | |
| 149, | |
| "quickcheck@4.6.2": | |
| 150, | |
| "quickcheck@4.7.0": | |
| 150, | |
| "quickcheck@5.0.0": | |
| 144, | |
| "quickcheck@6.0.0": | |
| 142, | |
| "quickcheck@6.1.0": | |
| 143, | |
| "quickcheck@7.0.0": | |
| 197, | |
| "quickcheck@7.1.0": | |
| 96, | |
| "quickcheck@8.0.0": | |
| 79, | |
| "quickcheck@8.0.1": | |
| 81, | |
| "quickcheck-combinators@0.0.0": | |
| 142, | |
| "quickcheck-combinators@0.1.0": | |
| 133, | |
| "quickcheck-combinators@0.1.1": | |
| 133, | |
| "quickcheck-combinators@0.1.2": | |
| 187, | |
| "quickcheck-combinators@0.1.3": | |
| 116, | |
| "quickcheck-laws@0.1.0": | |
| 79, | |
| "quickcheck-laws@0.1.1": | |
| 87, | |
| "quickcheck-laws@1.0.0": | |
| 75, | |
| "quickcheck-laws@2.0.0": | |
| 346, | |
| "quickcheck-laws@2.1.0": | |
| 182, | |
| "quickcheck-laws@3.0.0": | |
| 271, | |
| "quickcheck-laws@3.0.1": | |
| 403, | |
| "quickcheck-laws@4.0.0": | |
| 129, | |
| "quickcheck-laws@5.0.0": | |
| 135, | |
| "quickcheck-laws@5.0.1": | |
| 135, | |
| "quickcheck-laws@5.1.0": | |
| 243, | |
| "quickcheck-laws@6.0.0": | |
| 94, | |
| "quickcheck-laws@6.0.1": | |
| 94, | |
| "quickcheck-laws@7.0.0": | |
| 91, | |
| "quickcheck-mbt@0.0.2": | |
| 145, | |
| "quickcheck-mbt@0.0.3": | |
| 145, | |
| "quickcheck-mbt@0.0.4": | |
| 146, | |
| "quickcheck-mbt@0.0.5": | |
| 227, | |
| "quickcheck-mbt@0.0.6": | |
| 194, | |
| "quickcheck-mbt@0.0.7": | |
| 186, | |
| "quickcheck-mbt@0.0.8": | |
| 194, | |
| "quickcheck-mbt@0.0.9": | |
| 205, | |
| "quickcheck-state-machine@0.0.2": | |
| 147, | |
| "quickcheck-state-machine@0.0.3": | |
| 232, | |
| "quickcheck-state-machine@0.0.4": | |
| 131, | |
| "quickcheck-state-machine@0.0.5": | |
| 130, | |
| "quickcheck-state-machine@0.0.6": | |
| 194, | |
| "quickcheck-state-machine@0.0.7": | |
| 252, | |
| "quickcheck-state-machine@0.0.8": | |
| 223, | |
| "quickcheck-state-machine@0.0.9": | |
| 205, | |
| "quickcheck-utf8@0.0.0": | |
| 245, | |
| "quickserve@0.1.0": | |
| 564, | |
| "quickserve@0.2.0": | |
| 542, | |
| "quickserve@1.0.0": | |
| 557, | |
| "quickserve@2.0.0": | |
| 596, | |
| "quickserve@3.0.0": | |
| 545, | |
| "quill@0.1.0": | |
| 577, | |
| "quill@0.2.0": | |
| 357, | |
| "quill@0.3.0": | |
| 282, | |
| "quotient@0.0.1": | |
| 62, | |
| "quotient@0.0.2": | |
| 65, | |
| "quotient@0.0.3": | |
| 66, | |
| "quotient@0.0.4": | |
| 68, | |
| "quotient@0.0.5": | |
| 545, | |
| "quotient@0.0.6": | |
| 413, | |
| "quotient@1.0.0": | |
| 391, | |
| "quotient@2.0.0": | |
| 123, | |
| "quotient@3.0.0": | |
| 141, | |
| "ractive@0.1.0": | |
| 125, | |
| "ractive@0.1.2": | |
| 219, | |
| "ractive@0.1.3": | |
| -247, | |
| "ractive@0.1.4": | |
| -232, | |
| "radox@0.0.4": | |
| 102, | |
| "radox@0.0.5": | |
| 118, | |
| "radox@0.0.6": | |
| 118, | |
| "radox@0.0.7": | |
| 117, | |
| "radox@0.0.8": | |
| 118, | |
| "radox@1.0.0": | |
| 365, | |
| "random@0.1.0": | |
| 42, | |
| "random@0.1.1": | |
| 54, | |
| "random@0.1.2": | |
| 50, | |
| "random@0.1.3": | |
| 73, | |
| "random@0.2.0": | |
| 65, | |
| "random@0.2.1": | |
| 75, | |
| "random@0.2.2": | |
| 68, | |
| "random@0.2.3": | |
| 151, | |
| "random@1.0.0": | |
| 51, | |
| "random@2.0.0": | |
| 65, | |
| "random@3.0.0": | |
| 68, | |
| "random@4.0.0": | |
| 69, | |
| "random@5.0.0": | |
| 68, | |
| "random@6.0.0": | |
| 70, | |
| "random-secure@1.0.0": | |
| 307, | |
| "random-secure@2.0.0": | |
| 167, | |
| "random-words@0.0.1": | |
| 646, | |
| "rate-limit@0.0.1": | |
| 167, | |
| "rationals@0.3.2": | |
| 61, | |
| "rationals@0.4.0": | |
| 64, | |
| "rationals@1.0.0": | |
| 71, | |
| "rationals@2.0.0": | |
| 123, | |
| "rationals@2.1.0": | |
| 84, | |
| "rationals@2.1.1": | |
| 45, | |
| "rationals@2.1.2": | |
| 56, | |
| "rationals@3.0.0": | |
| 69, | |
| "rationals@3.1.0": | |
| 71, | |
| "rationals@3.1.1": | |
| 72, | |
| "rationals@4.0.0": | |
| 69, | |
| "rationals@5.0.0": | |
| 69, | |
| "rationals@5.0.1": | |
| 118, | |
| "rave@0.1.0": | |
| -287, | |
| "rave@0.1.1": | |
| 214, | |
| "rdf@0.1.0": | |
| 108, | |
| "rdkafka@0.1.0": | |
| 387, | |
| "rdkafka@0.1.1": | |
| 497, | |
| "react@0.0.2": | |
| 38, | |
| "react@0.0.3": | |
| 56, | |
| "react@0.0.4": | |
| 58, | |
| "react@0.0.5": | |
| 78, | |
| "react@0.1.0": | |
| 66, | |
| "react@0.1.1": | |
| 69, | |
| "react@0.1.2": | |
| 90, | |
| "react@0.2.0": | |
| 100, | |
| "react@0.3.0": | |
| 97, | |
| "react@0.4.0": | |
| 91, | |
| "react@0.4.1": | |
| 105, | |
| "react@0.4.2": | |
| 108, | |
| "react@0.4.3": | |
| 109, | |
| "react@0.5.0": | |
| 106, | |
| "react@0.6.0": | |
| 58, | |
| "react@0.7.0": | |
| 137, | |
| "react@0.7.1": | |
| 48, | |
| "react@1.0.0": | |
| 54, | |
| "react@1.1.0": | |
| 56, | |
| "react@1.2.0": | |
| 73, | |
| "react@1.3.0": | |
| 61, | |
| "react@2.0.0": | |
| 73, | |
| "react@3.0.0": | |
| 135, | |
| "react@4.0.0": | |
| 63, | |
| "react@4.1.0": | |
| 66, | |
| "react@4.2.0": | |
| 56, | |
| "react@4.3.0": | |
| 76, | |
| "react@4.4.0": | |
| 81, | |
| "react@5.0.0": | |
| 78, | |
| "react@5.0.1": | |
| 161, | |
| "react@5.1.0": | |
| 86, | |
| "react@6.0.0": | |
| 51, | |
| "react@6.1.0": | |
| 61, | |
| "react@7.0.0": | |
| 75, | |
| "react@7.0.1": | |
| 76, | |
| "react@8.0.0": | |
| 74, | |
| "react@9.0.0": | |
| 65, | |
| "react@10.0.0": | |
| 81, | |
| "react@10.0.1": | |
| 120, | |
| "react-addons-css-transition-group@0.1.0": | |
| 45, | |
| "react-addons-css-transition-group@0.2.0": | |
| 49, | |
| "react-addons-css-transition-group@0.2.1": | |
| 504, | |
| "react-addons-perf@0.1.0": | |
| 69, | |
| "react-aria@0.1.0": | |
| 159, | |
| "react-aria@0.2.0": | |
| 145, | |
| "react-basic@0.2.0": | |
| 67, | |
| "react-basic@0.3.0": | |
| 136, | |
| "react-basic@0.4.0": | |
| 62, | |
| "react-basic@0.5.0": | |
| 59, | |
| "react-basic@0.6.0": | |
| 66, | |
| "react-basic@0.7.0": | |
| 81, | |
| "react-basic@0.7.1": | |
| 96, | |
| "react-basic@0.8.0": | |
| 67, | |
| "react-basic@0.9.0": | |
| 82, | |
| "react-basic@0.10.0": | |
| 130, | |
| "react-basic@0.10.1": | |
| 70, | |
| "react-basic@0.10.2": | |
| 58, | |
| "react-basic@1.0.0": | |
| 94, | |
| "react-basic@1.1.0": | |
| 83, | |
| "react-basic@1.1.1": | |
| 81, | |
| "react-basic@1.1.2": | |
| 150, | |
| "react-basic@1.2.0": | |
| 73, | |
| "react-basic@2.0.0": | |
| 236, | |
| "react-basic@2.0.1": | |
| 264, | |
| "react-basic@2.0.2": | |
| 237, | |
| "react-basic@2.1.0": | |
| 238, | |
| "react-basic@3.0.0": | |
| 331, | |
| "react-basic@4.0.0": | |
| 338, | |
| "react-basic@4.0.1": | |
| 327, | |
| "react-basic@4.0.2": | |
| 329, | |
| "react-basic@4.0.3": | |
| 344, | |
| "react-basic@5.0.0": | |
| 345, | |
| "react-basic@5.0.1": | |
| 350, | |
| "react-basic@6.0.0": | |
| 352, | |
| "react-basic@6.1.0": | |
| 440, | |
| "react-basic@6.2.0": | |
| 336, | |
| "react-basic@7.0.0": | |
| 328, | |
| "react-basic@8.0.0": | |
| 348, | |
| "react-basic@8.0.1": | |
| 371, | |
| "react-basic@9.0.0": | |
| 466, | |
| "react-basic@9.0.1": | |
| 381, | |
| "react-basic@10.0.0": | |
| 351, | |
| "react-basic@11.0.0": | |
| 355, | |
| "react-basic@11.1.0": | |
| 368, | |
| "react-basic@12.0.0": | |
| 308, | |
| "react-basic@13.0.0": | |
| 312, | |
| "react-basic@14.0.0": | |
| 319, | |
| "react-basic@15.0.0": | |
| 153, | |
| "react-basic@16.0.0": | |
| 40, | |
| "react-basic@17.0.0": | |
| 51, | |
| "react-basic-classic@1.0.0": | |
| 262, | |
| "react-basic-classic@1.0.1": | |
| 232, | |
| "react-basic-classic@2.0.0": | |
| 203, | |
| "react-basic-classic@3.0.0": | |
| 87, | |
| "react-basic-compat@1.0.0": | |
| 253, | |
| "react-basic-compat@1.0.1": | |
| 245, | |
| "react-basic-dnd@1.0.0": | |
| 336, | |
| "react-basic-dnd@2.0.0": | |
| 255, | |
| "react-basic-dnd@3.0.0": | |
| 376, | |
| "react-basic-dnd@5.0.0": | |
| 417, | |
| "react-basic-dnd@6.0.0": | |
| 629, | |
| "react-basic-dnd@6.1.0": | |
| 446, | |
| "react-basic-dnd@6.1.1": | |
| 428, | |
| "react-basic-dnd@6.1.2": | |
| 444, | |
| "react-basic-dnd@6.1.3": | |
| 453, | |
| "react-basic-dnd@6.1.4": | |
| 454, | |
| "react-basic-dnd@6.1.5": | |
| 582, | |
| "react-basic-dnd@7.0.0": | |
| 388, | |
| "react-basic-dnd@8.0.0": | |
| 699, | |
| "react-basic-dnd@9.0.0": | |
| 126, | |
| "react-basic-dnd@10.0.0": | |
| 128, | |
| "react-basic-dnd@10.1.0": | |
| 127, | |
| "react-basic-dom@1.0.0": | |
| 244, | |
| "react-basic-dom@2.0.0": | |
| 332, | |
| "react-basic-dom@2.0.1": | |
| 224, | |
| "react-basic-dom@3.0.0": | |
| 225, | |
| "react-basic-dom@3.1.0": | |
| 228, | |
| "react-basic-dom@3.2.0": | |
| 244, | |
| "react-basic-dom@3.3.0": | |
| 239, | |
| "react-basic-dom@4.0.0": | |
| 160, | |
| "react-basic-dom@4.0.1": | |
| 159, | |
| "react-basic-dom@4.1.0": | |
| 265, | |
| "react-basic-dom@4.2.0": | |
| 147, | |
| "react-basic-dom@5.0.0": | |
| 102, | |
| "react-basic-dom@5.0.1": | |
| 106, | |
| "react-basic-dom@6.0.0": | |
| 111, | |
| "react-basic-emotion@1.0.0": | |
| 424, | |
| "react-basic-emotion@2.0.0": | |
| 418, | |
| "react-basic-emotion@3.0.0": | |
| 500, | |
| "react-basic-emotion@4.0.0": | |
| 396, | |
| "react-basic-emotion@4.0.1": | |
| 399, | |
| "react-basic-emotion@4.1.0": | |
| 426, | |
| "react-basic-emotion@4.2.0": | |
| 411, | |
| "react-basic-emotion@4.2.1": | |
| 532, | |
| "react-basic-emotion@4.2.2": | |
| 390, | |
| "react-basic-emotion@4.3.0": | |
| 392, | |
| "react-basic-emotion@4.4.0": | |
| 406, | |
| "react-basic-emotion@5.0.0": | |
| 412, | |
| "react-basic-emotion@6.0.0": | |
| 172, | |
| "react-basic-emotion@6.0.1": | |
| 175, | |
| "react-basic-emotion@7.0.0": | |
| 200, | |
| "react-basic-emotion@7.1.0": | |
| 108, | |
| "react-basic-hooks@0.1.0": | |
| 354, | |
| "react-basic-hooks@0.2.0": | |
| 369, | |
| "react-basic-hooks@0.3.0": | |
| 364, | |
| "react-basic-hooks@0.4.0": | |
| 497, | |
| "react-basic-hooks@0.5.0": | |
| 392, | |
| "react-basic-hooks@0.6.0": | |
| 384, | |
| "react-basic-hooks@0.6.1": | |
| 411, | |
| "react-basic-hooks@0.7.0": | |
| 403, | |
| "react-basic-hooks@0.7.1": | |
| 538, | |
| "react-basic-hooks@1.0.0": | |
| 407, | |
| "react-basic-hooks@1.0.1": | |
| 513, | |
| "react-basic-hooks@2.0.0": | |
| 380, | |
| "react-basic-hooks@2.0.1": | |
| 658, | |
| "react-basic-hooks@2.0.2": | |
| 379, | |
| "react-basic-hooks@2.0.3": | |
| 512, | |
| "react-basic-hooks@3.0.0": | |
| 386, | |
| "react-basic-hooks@4.0.0": | |
| 613, | |
| "react-basic-hooks@4.1.0": | |
| 395, | |
| "react-basic-hooks@4.1.1": | |
| 616, | |
| "react-basic-hooks@4.2.0": | |
| 733, | |
| "react-basic-hooks@4.2.1": | |
| 604, | |
| "react-basic-hooks@4.2.2": | |
| 587, | |
| "react-basic-hooks@5.0.0": | |
| 624, | |
| "react-basic-hooks@5.0.1": | |
| 626, | |
| "react-basic-hooks@5.1.0": | |
| 790, | |
| "react-basic-hooks@5.2.0": | |
| 605, | |
| "react-basic-hooks@6.0.0": | |
| 298, | |
| "react-basic-hooks@6.1.0": | |
| 307, | |
| "react-basic-hooks@6.1.1": | |
| 325, | |
| "react-basic-hooks@6.2.0": | |
| 318, | |
| "react-basic-hooks@6.3.0": | |
| 319, | |
| "react-basic-hooks@7.0.0": | |
| 265, | |
| "react-basic-hooks@7.0.1": | |
| 132, | |
| "react-basic-hooks@8.0.0": | |
| 102, | |
| "react-basic-hooks@8.1.2": | |
| 107, | |
| "react-basic-native@0.1.0": | |
| 423, | |
| "react-basic-native@0.1.1": | |
| 390, | |
| "react-basic-native@0.1.2": | |
| 389, | |
| "react-basic-native@0.1.3": | |
| 510, | |
| "react-basic-storybook@1.0.0": | |
| 45, | |
| "react-basic-storybook@2.0.0": | |
| 108, | |
| "react-basic-textf@0.1.0": | |
| 402, | |
| "react-basic-textf@0.1.1": | |
| 423, | |
| "react-basic-textf@0.2.0": | |
| 407, | |
| "react-basic-textf@0.3.0": | |
| 508, | |
| "react-dom@0.1.0": | |
| 98, | |
| "react-dom@0.2.0": | |
| 93, | |
| "react-dom@1.0.0": | |
| 59, | |
| "react-dom@2.0.0": | |
| 414, | |
| "react-dom@3.0.0": | |
| 425, | |
| "react-dom@4.0.0": | |
| 676, | |
| "react-dom@4.1.0": | |
| 650, | |
| "react-dom@5.0.0": | |
| 757, | |
| "react-dom@6.0.0": | |
| 246, | |
| "react-dom@6.0.1": | |
| 244, | |
| "react-dom@6.1.0": | |
| 262, | |
| "react-dom@7.0.0": | |
| 140, | |
| "react-dom@8.0.0": | |
| 120, | |
| "react-enzyme@1.0.1": | |
| 402, | |
| "react-enzyme@1.1.0": | |
| 268, | |
| "react-enzyme@1.1.1": | |
| 265, | |
| "react-event-listener@0.0.0": | |
| 217, | |
| "react-explore@1.0.0": | |
| 311, | |
| "react-explore@1.1.0": | |
| 307, | |
| "react-explore@2.0.0": | |
| 154, | |
| "react-explore@2.1.0": | |
| 261, | |
| "react-halo@0.0.1": | |
| 294, | |
| "react-halo@0.1.0": | |
| 281, | |
| "react-halo@0.1.1": | |
| 278, | |
| "react-halo@0.1.2": | |
| 296, | |
| "react-halo@0.2.0": | |
| 297, | |
| "react-halo@0.2.1": | |
| 293, | |
| "react-halo@0.2.2": | |
| 293, | |
| "react-halo@0.2.3": | |
| 400, | |
| "react-halo@1.0.0": | |
| 242, | |
| "react-halo@1.1.0": | |
| 239, | |
| "react-halo@1.2.0": | |
| 265, | |
| "react-halo@1.2.1": | |
| 269, | |
| "react-halo@2.0.0": | |
| 178, | |
| "react-halo@3.0.0": | |
| 252, | |
| "react-hocs@0.0.1": | |
| 1155, | |
| "react-hocs@0.1.0": | |
| 1119, | |
| "react-hocs@0.2.0": | |
| 1133, | |
| "react-hocs@0.3.0": | |
| 1031, | |
| "react-hocs@0.3.1": | |
| 1145, | |
| "react-hocs@0.4.0": | |
| 1007, | |
| "react-hocs@0.5.0": | |
| 1005, | |
| "react-hocs@0.5.1": | |
| 1028, | |
| "react-hocs@0.6.0": | |
| 460, | |
| "react-hocs@0.6.1": | |
| 739, | |
| "react-hocs@0.6.2": | |
| 880, | |
| "react-hocs@0.7.0": | |
| 722, | |
| "react-hocs@0.7.1": | |
| 712, | |
| "react-hocs@0.7.2": | |
| 732, | |
| "react-hocs@0.8.0": | |
| 737, | |
| "react-icons@1.0.0": | |
| 124, | |
| "react-icons@1.0.1": | |
| 126, | |
| "react-icons@1.0.2": | |
| 248, | |
| "react-icons@1.0.3": | |
| 120, | |
| "react-icons@1.0.4": | |
| 113, | |
| "react-icons@1.0.5": | |
| 115, | |
| "react-icons@1.0.6": | |
| 127, | |
| "react-icons@1.0.7": | |
| 129, | |
| "react-icons@1.0.8": | |
| 131, | |
| "react-ix@0.1.1": | |
| 765, | |
| "react-ix@0.1.2": | |
| 862, | |
| "react-ix@0.2.0": | |
| 526, | |
| "react-ix@0.3.0": | |
| 525, | |
| "react-ix@0.3.1": | |
| 548, | |
| "react-ix@0.4.0": | |
| 546, | |
| "react-ix@0.5.0": | |
| 551, | |
| "react-ix@0.5.1": | |
| 667, | |
| "react-ix@0.5.2": | |
| 538, | |
| "react-ix@0.5.3": | |
| 590, | |
| "react-keybind@0.8.1": | |
| 259, | |
| "react-keybind@0.9.4": | |
| 6651, | |
| "react-material-ui@0.1.0": | |
| 743, | |
| "react-material-ui@1.0.0": | |
| 637, | |
| "react-mui@3.1.0": | |
| 451, | |
| "react-mui@3.6.0": | |
| 459, | |
| "react-mui@3.9.2": | |
| 453, | |
| "react-mui@3.9.3": | |
| 455, | |
| "react-mui@3.9.313": | |
| -420, | |
| "react-queue@0.0.0": | |
| 901, | |
| "react-queue@0.0.1": | |
| 800, | |
| "react-queue@0.0.2": | |
| 700, | |
| "react-queue@0.0.3": | |
| 555, | |
| "react-queue@0.0.4": | |
| 569, | |
| "react-queue@0.0.5": | |
| 564, | |
| "react-queue@0.0.6": | |
| 558, | |
| "react-queue@0.0.7": | |
| 566, | |
| "react-queue@0.0.8": | |
| 704, | |
| "react-queue@0.1.0": | |
| 542, | |
| "react-queue@1.0.0": | |
| 372, | |
| "react-queue@1.0.1": | |
| 370, | |
| "react-queue@1.0.2": | |
| 440, | |
| "react-queue@1.1.0": | |
| 399, | |
| "react-queue@1.2.0": | |
| 404, | |
| "react-queue@1.2.1": | |
| 564, | |
| "react-queue@1.3.0": | |
| 386, | |
| "react-queue@1.3.1": | |
| 311, | |
| "react-queue@1.3.2": | |
| 312, | |
| "react-radox@0.0.1": | |
| 129, | |
| "react-radox@0.0.2": | |
| 129, | |
| "react-radox@0.0.3": | |
| 129, | |
| "react-radox@0.0.4": | |
| 224, | |
| "react-radox@0.0.5": | |
| 129, | |
| "react-redox@0.1.1": | |
| 1259, | |
| "react-redox@0.2.0": | |
| 1250, | |
| "react-redox@0.2.1": | |
| 1250, | |
| "react-redox@0.3.0": | |
| 1254, | |
| "react-redox@0.4.0": | |
| 1421, | |
| "react-redox@0.5.0": | |
| 1231, | |
| "react-redox@0.5.1": | |
| 1289, | |
| "react-redox@0.5.2": | |
| 1284, | |
| "react-redox@0.5.3": | |
| 1306, | |
| "react-redox@0.5.4": | |
| 1293, | |
| "react-redox@0.6.0": | |
| 1408, | |
| "react-redox@0.7.1": | |
| 1271, | |
| "react-redox@0.8.0": | |
| 1197, | |
| "react-redox@0.8.1": | |
| 1198, | |
| "react-redox@0.9.0": | |
| 1115, | |
| "react-redox@0.9.1": | |
| 1240, | |
| "react-redox@0.9.2": | |
| 784, | |
| "react-redox@0.9.3": | |
| 789, | |
| "react-redox@0.10.0": | |
| 776, | |
| "react-redox@0.10.1": | |
| 811, | |
| "react-redox@0.10.2": | |
| 950, | |
| "react-redox@1.0.0": | |
| 790, | |
| "react-redox@2.0.0": | |
| 834, | |
| "react-redox@2.0.1": | |
| 836, | |
| "react-redox@3.2.0": | |
| 822, | |
| "react-redux@0.1.0": | |
| -108, | |
| "react-redux@1.0.0": | |
| 183, | |
| "react-redux@2.0.0": | |
| 381, | |
| "react-redux@3.0.0": | |
| 340, | |
| "react-redux@4.0.0": | |
| 341, | |
| "react-redux@5.0.0": | |
| 502, | |
| "react-redux@5.1.0": | |
| 503, | |
| "react-redux@6.1.0": | |
| 145, | |
| "react-router@0.1.0": | |
| -359, | |
| "react-router@0.1.1": | |
| -259, | |
| "react-router@0.2.0": | |
| -266, | |
| "react-router@0.2.1": | |
| -275, | |
| "react-router@0.2.2": | |
| -269, | |
| "react-router@1.0.0": | |
| -273, | |
| "react-select-basic@0.1.0": | |
| 340, | |
| "react-select-basic@0.2.0": | |
| 255, | |
| "react-select-basic@1.0.0": | |
| 497, | |
| "react-simple@0.0.2": | |
| 41, | |
| "react-simple@0.0.3": | |
| 66, | |
| "react-simple@0.0.4": | |
| 68, | |
| "react-simple@0.0.5": | |
| 68, | |
| "react-simple@0.0.6": | |
| 66, | |
| "react-simple@0.1.0": | |
| 68, | |
| "react-simple@0.1.1": | |
| 116, | |
| "react-simple@0.1.2": | |
| 47, | |
| "react-spaces@0.1.0": | |
| 376, | |
| "react-spaces@0.2.0": | |
| 315, | |
| "react-spaces@0.3.0": | |
| 315, | |
| "react-spaces@0.4.0": | |
| 307, | |
| "react-spaces@0.4.1": | |
| 426, | |
| "react-spaces@0.4.2": | |
| 298, | |
| "react-spaces@0.4.3": | |
| 308, | |
| "react-spaces@0.4.4": | |
| 311, | |
| "react-spaces@0.4.5": | |
| 308, | |
| "react-spaces@0.4.6": | |
| 310, | |
| "react-spaces@0.5.0": | |
| 440, | |
| "react-spaces@1.0.0": | |
| 298, | |
| "react-spaces@1.0.1": | |
| 311, | |
| "react-stylesheet@0.0.2": | |
| 474, | |
| "react-testing-library@0.1.0": | |
| 318, | |
| "react-testing-library@1.0.0": | |
| 315, | |
| "react-testing-library@2.0.0": | |
| 318, | |
| "react-testing-library@3.0.0": | |
| 305, | |
| "react-testing-library@3.1.0": | |
| 208, | |
| "react-testing-library@3.1.4": | |
| 218, | |
| "react-testing-library@4.0.1": | |
| 140, | |
| "react-transition-group@0.1.0": | |
| 67, | |
| "react-transition-group@0.1.1": | |
| 198, | |
| "react-transition-group-2@0.0.0": | |
| 392, | |
| "react-virtuoso@1.0.0": | |
| 133, | |
| "reactnative@1.0.0": | |
| 311, | |
| "reactnative@2.39.0": | |
| 164, | |
| "reactnative@2.42.0": | |
| 171, | |
| "reactnative@3.0.0": | |
| 345, | |
| "reactnative@3.0.1": | |
| 340, | |
| "reactnative@4.0.0": | |
| 338, | |
| "reactnative@4.0.1": | |
| 340, | |
| "reactnative@5.0.0": | |
| 294, | |
| "reactnative@5.0.1": | |
| 175, | |
| "reactnative@6.0.0": | |
| 104, | |
| "reactnative@6.0.1": | |
| 108, | |
| "reactnative@6.0.2": | |
| 110, | |
| "reactnative@6.0.3": | |
| 107, | |
| "read@1.0.0": | |
| 146, | |
| "read@1.0.1": | |
| 126, | |
| "read-generic@1.0.0": | |
| 197, | |
| "read-generic@1.0.1": | |
| 111, | |
| "read-generic@1.0.2": | |
| 113, | |
| "read-generic@1.0.3": | |
| 123, | |
| "read-generic@1.0.4": | |
| 122, | |
| "read-generic@1.0.5": | |
| 122, | |
| "read-generic@1.0.6": | |
| 121, | |
| "read-generic@1.0.7": | |
| 125, | |
| "recompose@1.0.0": | |
| 94, | |
| "recompose@1.0.1": | |
| 105, | |
| "recompose@1.1.0": | |
| 47, | |
| "record@0.1.0": | |
| 81, | |
| "record@0.2.0": | |
| 71, | |
| "record@0.2.1": | |
| 72, | |
| "record@0.2.2": | |
| 75, | |
| "record@0.2.3": | |
| 73, | |
| "record@0.2.4": | |
| 72, | |
| "record@0.2.5": | |
| 144, | |
| "record@0.2.6": | |
| 78, | |
| "record@1.0.0": | |
| 93, | |
| "record@2.0.0": | |
| 87, | |
| "record@2.0.1": | |
| 128, | |
| "record@2.0.2": | |
| 121, | |
| "record@3.0.0": | |
| 68, | |
| "record@4.0.0": | |
| 137, | |
| "record-extra@0.1.0": | |
| 111, | |
| "record-extra@0.2.0": | |
| 114, | |
| "record-extra@0.3.0": | |
| 113, | |
| "record-extra@0.4.0": | |
| 91, | |
| "record-extra@1.0.0": | |
| 96, | |
| "record-extra@2.0.0": | |
| 95, | |
| "record-extra@2.0.1": | |
| 93, | |
| "record-extra@2.0.2": | |
| 216, | |
| "record-extra@2.0.3": | |
| 96, | |
| "record-extra@3.0.0": | |
| 95, | |
| "record-extra@3.0.1": | |
| 98, | |
| "record-extra@4.0.0": | |
| 91, | |
| "record-extra@5.0.0": | |
| 88, | |
| "record-extra@5.0.1": | |
| 99, | |
| "record-extra-srghma@0.1.0": | |
| 101, | |
| "record-fold@0.1.0": | |
| 209, | |
| "record-fold@0.3.0": | |
| 89, | |
| "record-fold@0.4.0": | |
| 100, | |
| "record-format@0.0.1": | |
| 116, | |
| "record-format@0.1.0": | |
| 110, | |
| "record-format@1.0.0": | |
| 111, | |
| "record-format@2.0.0": | |
| 110, | |
| "record-format@3.0.0": | |
| 97, | |
| "record-prefix@0.1.0": | |
| 245, | |
| "record-prefix@0.2.0": | |
| 125, | |
| "record-prefix@0.2.1": | |
| 135, | |
| "record-prefix@0.3.0": | |
| 137, | |
| "record-prefix@1.0.0": | |
| 139, | |
| "record-prefix@2.0.0": | |
| 210, | |
| "record-show@0.1.0": | |
| 105, | |
| "record-show@0.1.1": | |
| 186, | |
| "record-show@0.2.0": | |
| 93, | |
| "record-show@0.2.1": | |
| 108, | |
| "record-show@0.3.0": | |
| 111, | |
| "record-show@0.3.1": | |
| 111, | |
| "record-show@0.4.0": | |
| 110, | |
| "record-studio@0.1.0": | |
| 343, | |
| "record-studio@0.2.1": | |
| 73, | |
| "record-studio@1.0.0": | |
| 76, | |
| "record-studio@1.0.1": | |
| 85, | |
| "record-studio@1.0.2": | |
| 91, | |
| "record-studio@1.0.3": | |
| 85, | |
| "record-studio@1.0.4": | |
| 83, | |
| "records@0.0.1": | |
| 56, | |
| "records@0.0.2": | |
| 153, | |
| "records@0.0.3": | |
| 58, | |
| "records@1.0.0": | |
| 62, | |
| "redis@0.0.1": | |
| -260, | |
| "redis@0.0.2": | |
| -218, | |
| "redis@0.0.3": | |
| -207, | |
| "redis-client@0.2.0": | |
| 554, | |
| "redis-client@0.3.0": | |
| 526, | |
| "redis-client@0.3.1": | |
| 637, | |
| "redis-client@0.3.2": | |
| 504, | |
| "redis-client@0.3.3": | |
| 516, | |
| "redis-client@0.4.0": | |
| 513, | |
| "redis-client@0.4.1": | |
| 515, | |
| "redis-client@0.5.0": | |
| 515, | |
| "redis-client@1.0.0": | |
| 354, | |
| "redis-client@1.0.1": | |
| 325, | |
| "redis-hotqueue@0.1.0": | |
| 623, | |
| "redis-hotqueue@0.2.0": | |
| 602, | |
| "redis-hotqueue@0.2.1": | |
| 502, | |
| "redox@1.0.0": | |
| 252, | |
| "redox@1.0.1": | |
| 361, | |
| "redox@1.0.2": | |
| 241, | |
| "redox@2.0.0": | |
| 299, | |
| "redox@2.1.0": | |
| 301, | |
| "redox@3.0.0": | |
| 299, | |
| "redox@3.1.0": | |
| 299, | |
| "redox@3.2.0": | |
| 434, | |
| "redox@4.0.0": | |
| 292, | |
| "redox@5.0.0": | |
| 304, | |
| "redox@5.1.0": | |
| 326, | |
| "redox@5.1.1": | |
| 326, | |
| "redox@6.0.0": | |
| 330, | |
| "redox@6.0.1": | |
| 335, | |
| "redox@6.0.2": | |
| 458, | |
| "redox@6.0.3": | |
| 315, | |
| "redox@6.1.0": | |
| 298, | |
| "redox@6.2.0": | |
| 308, | |
| "redox@7.0.0": | |
| 479, | |
| "redox@7.0.1": | |
| 482, | |
| "redox@7.1.0": | |
| 587, | |
| "redox@7.2.0": | |
| 459, | |
| "redox@7.2.1": | |
| 470, | |
| "redox@7.3.0": | |
| 477, | |
| "redox@8.0.0": | |
| 196, | |
| "redux@0.1.0": | |
| -81, | |
| "redux@0.1.1": | |
| -84, | |
| "redux@0.1.2": | |
| 81, | |
| "redux@0.1.3": | |
| 192, | |
| "redux@0.1.4": | |
| 80, | |
| "redux@0.1.5": | |
| 74, | |
| "redux@0.1.6": | |
| 179, | |
| "redux@0.1.7": | |
| 169, | |
| "redux-devtools@0.1.0": | |
| 191, | |
| "redux-saga@0.1.0": | |
| 736, | |
| "redux-utils@0.1.0": | |
| 191, | |
| "redux-utils@0.2.0": | |
| 80, | |
| "redux-utils@0.3.0": | |
| 88, | |
| "refined@0.1.1": | |
| 457, | |
| "refined@0.1.2": | |
| 440, | |
| "refined@0.2.0": | |
| 338, | |
| "refined@1.0.0": | |
| 425, | |
| "reflection@1.0.1": | |
| 55, | |
| "reflection@2.0.0": | |
| 65, | |
| "reflection@3.0.0": | |
| 71, | |
| "reflection@3.1.0": | |
| 74, | |
| "reflection@4.0.0": | |
| 73, | |
| "refract@0.0.2": | |
| 467, | |
| "refract@0.0.3": | |
| 445, | |
| "refractor@0.1.1": | |
| -149, | |
| "refractor@0.2.0": | |
| 92, | |
| "refractor@0.3.0": | |
| 80, | |
| "refractor@0.4.0": | |
| 82, | |
| "refractor-coproduct@0.1.0": | |
| 82, | |
| "refs@0.1.0": | |
| 60, | |
| "refs@0.1.1": | |
| 76, | |
| "refs@0.1.2": | |
| 69, | |
| "refs@0.1.3": | |
| 126, | |
| "refs@0.2.0": | |
| 46, | |
| "refs@1.0.0": | |
| 71, | |
| "refs@2.0.0": | |
| 70, | |
| "refs@3.0.0": | |
| 74, | |
| "refs@4.0.0": | |
| 70, | |
| "refs@4.1.0": | |
| 121, | |
| "refs@5.0.0": | |
| 51, | |
| "refs@6.0.0": | |
| 66, | |
| "refty@0.1.0": | |
| 405, | |
| "refty@0.2.0": | |
| 351, | |
| "refty@0.3.0": | |
| 354, | |
| "refty@0.3.1": | |
| 389, | |
| "refty@0.4.0": | |
| 219, | |
| "refty@1.0.0": | |
| 253, | |
| "refty@1.1.0": | |
| 261, | |
| "refty@1.2.0": | |
| 257, | |
| "rehtie@0.1.0": | |
| 74, | |
| "rehtie@1.0.0": | |
| 71, | |
| "remotecallback@2.0.1": | |
| -223, | |
| "remotedata@1.0.0": | |
| -405, | |
| "remotedata@1.0.1": | |
| -263, | |
| "remotedata@1.1.0": | |
| -222, | |
| "remotedata@2.0.0": | |
| -209, | |
| "remotedata@2.1.0": | |
| 433, | |
| "remotedata@2.1.1": | |
| 565, | |
| "remotedata@2.2.0": | |
| 429, | |
| "remotedata@3.0.0": | |
| 587, | |
| "remotedata@4.0.0": | |
| 188, | |
| "remotedata@4.1.0": | |
| 283, | |
| "remotedata@4.2.0": | |
| 219, | |
| "remotedata@5.0.0": | |
| 110, | |
| "repr@0.2.0": | |
| 138, | |
| "repr@0.3.0": | |
| 179, | |
| "repr@0.3.1": | |
| 110, | |
| "requestanimationframe@0.0.1": | |
| 44, | |
| "requestanimationframe@0.0.2": | |
| 73, | |
| "requestanimationframe@0.0.3": | |
| 66, | |
| "requestanimationframe@1.0.0": | |
| 129, | |
| "requests@0.0.1": | |
| -300, | |
| "requests@0.0.2": | |
| -371, | |
| "requests@0.0.3": | |
| -488, | |
| "requests@0.0.4": | |
| 421, | |
| "resource@1.0.0": | |
| 299, | |
| "resource@2.0.0": | |
| 251, | |
| "resource@2.0.1": | |
| 125, | |
| "resourcet@0.1.0": | |
| 184, | |
| "resourcet@1.0.0": | |
| 123, | |
| "rest@0.1.0": | |
| -228, | |
| "restify@0.0.1": | |
| 507, | |
| "restify-router@0.0.1": | |
| 732, | |
| "restify-router@0.0.2": | |
| 735, | |
| "result@0.1.0": | |
| 73, | |
| "result@1.0.0": | |
| 71, | |
| "result@1.0.1": | |
| 74, | |
| "result@1.0.2": | |
| 76, | |
| "result@1.0.3": | |
| 161, | |
| "return@0.1.0": | |
| 211, | |
| "return@0.1.1": | |
| -119, | |
| "return@0.1.2": | |
| -78, | |
| "return@0.1.3": | |
| -76, | |
| "return@0.1.4": | |
| -76, | |
| "return@0.2.0": | |
| -71, | |
| "ring-modules@2.1.0": | |
| 135, | |
| "ring-modules@2.2.0": | |
| 48, | |
| "ring-modules@3.0.0": | |
| 68, | |
| "ring-modules@4.0.0": | |
| 68, | |
| "ring-modules@5.0.0": | |
| 68, | |
| "ring-modules@5.0.1": | |
| 67, | |
| "rito@0.0.0": | |
| -322, | |
| "rito@0.0.2": | |
| -388, | |
| "rito@0.0.3": | |
| -172, | |
| "rito@0.1.0": | |
| -181, | |
| "rito@0.3.2": | |
| -181, | |
| "rmrk-parser@0.2.0": | |
| 188, | |
| "rmrk-parser@0.2.1": | |
| 183, | |
| "rmrk-parser@0.2.2": | |
| 292, | |
| "rmrk-parser@0.2.3": | |
| 169, | |
| "rmrk-parser@0.2.4": | |
| 183, | |
| "rmrk-parser@0.2.5": | |
| 185, | |
| "rmrk-parser@0.2.6": | |
| 185, | |
| "rmrk-parser@0.2.7": | |
| 181, | |
| "rmrk-parser@0.2.8": | |
| 187, | |
| "rmrk-parser@0.2.10": | |
| 295, | |
| "rmrk-parser@0.2.13": | |
| 169, | |
| "roman@0.2.0": | |
| 229, | |
| "roman@0.2.1": | |
| 125, | |
| "rotjs@0.0.1": | |
| 81, | |
| "rout@1.0.0": | |
| 141, | |
| "rout@2.0.0": | |
| 325, | |
| "rout@2.1.0": | |
| 208, | |
| "rout@2.1.1": | |
| 332, | |
| "rout@2.2.0": | |
| 180, | |
| "rout@3.0.0": | |
| 131, | |
| "routing@0.1.0": | |
| 86, | |
| "routing@0.2.0": | |
| 117, | |
| "routing@0.2.1": | |
| 119, | |
| "routing@0.3.0": | |
| 115, | |
| "routing@0.4.0": | |
| 193, | |
| "routing@1.0.0": | |
| 70, | |
| "routing@2.0.0": | |
| -191, | |
| "routing@3.0.0": | |
| -369, | |
| "routing@3.1.0": | |
| -363, | |
| "routing@4.0.0": | |
| -363, | |
| "routing@5.0.0": | |
| 454, | |
| "routing@5.1.0": | |
| 454, | |
| "routing@6.0.0": | |
| 565, | |
| "routing@6.1.0": | |
| 452, | |
| "routing@6.1.1": | |
| 457, | |
| "routing@6.1.2": | |
| 455, | |
| "routing@7.0.0": | |
| 449, | |
| "routing@7.1.0": | |
| 488, | |
| "routing@8.0.0": | |
| 259, | |
| "routing@9.0.0": | |
| 279, | |
| "routing@9.0.1": | |
| 282, | |
| "routing@10.0.0": | |
| 137, | |
| "routing@10.0.1": | |
| 136, | |
| "routing@11.0.0": | |
| 109, | |
| "routing-bob@0.0.1": | |
| 91, | |
| "routing-bob@0.0.2": | |
| 167, | |
| "routing-bob@0.0.3": | |
| 79, | |
| "routing-bob@0.0.4": | |
| 90, | |
| "routing-bob@0.0.5": | |
| 90, | |
| "routing-bob@0.0.6": | |
| 88, | |
| "routing-bob@0.0.7": | |
| 200, | |
| "routing-bob@0.0.8": | |
| 80, | |
| "routing-bob@0.0.9": | |
| 68, | |
| "routing-bob@0.1.0": | |
| 77, | |
| "routing-bob@0.1.1": | |
| 81, | |
| "routing-bob@0.2.0": | |
| -581, | |
| "routing-bob@0.4.0": | |
| 248, | |
| "routing-bob@0.4.1": | |
| -526, | |
| "routing-bob@0.4.2": | |
| -404, | |
| "routing-bob@0.5.0": | |
| 477, | |
| "routing-bob@0.5.1": | |
| 472, | |
| "routing-bob@0.6.0": | |
| 458, | |
| "routing-bob@0.6.1": | |
| 458, | |
| "routing-duplex@0.1.0": | |
| 121, | |
| "routing-duplex@0.2.0": | |
| 212, | |
| "routing-duplex@0.3.0": | |
| 118, | |
| "routing-duplex@0.4.0": | |
| 112, | |
| "routing-duplex@0.4.1": | |
| 125, | |
| "routing-duplex@0.5.0": | |
| 91, | |
| "routing-duplex@0.5.1": | |
| 91, | |
| "routing-duplex@0.6.0": | |
| 87, | |
| "routing-duplex@0.7.0": | |
| 95, | |
| "row-extra@0.0.0": | |
| 80, | |
| "row-extra@0.0.1": | |
| 116, | |
| "rrb-list@0.0.1": | |
| 88, | |
| "run@0.1.0": | |
| 373, | |
| "run@0.2.0": | |
| 362, | |
| "run@0.3.0": | |
| 349, | |
| "run@0.4.0": | |
| 473, | |
| "run@1.0.0": | |
| 344, | |
| "run@1.0.1": | |
| 443, | |
| "run@1.1.0": | |
| 330, | |
| "run@2.0.0": | |
| 177, | |
| "run@3.0.0": | |
| 209, | |
| "run@3.0.1": | |
| 193, | |
| "run@4.0.0": | |
| 118, | |
| "run@5.0.0": | |
| 99, | |
| "run-console-experiment@1.0.0": | |
| 492, | |
| "run-console-experiment@1.0.1": | |
| 615, | |
| "run-console-experiment@1.0.2": | |
| 478, | |
| "run-console-experiment@1.0.3": | |
| 488, | |
| "run-console-experiment@1.1.0": | |
| 488, | |
| "run-console-experiment@1.1.1": | |
| 484, | |
| "run-console-experiment@1.1.2": | |
| 485, | |
| "run-console-experiment@2.0.0": | |
| 567, | |
| "run-console-experiment@2.0.1": | |
| 439, | |
| "run-external-state@1.0.0": | |
| 131, | |
| "run-halogen@0.1.0": | |
| 385, | |
| "run-profunctor-lenses@0.1.0": | |
| 260, | |
| "run-streaming@0.1.0": | |
| 491, | |
| "run-streaming@1.0.0": | |
| 453, | |
| "run-streaming@2.0.0": | |
| 246, | |
| "run-supply@1.0.0": | |
| 341, | |
| "rwse-free@0.1.0": | |
| 86, | |
| "rwse-free@0.1.1": | |
| 101, | |
| "rwse-free@1.0.0": | |
| 322, | |
| "rwse-free@2.0.0": | |
| 322, | |
| "rwse-free@2.1.0": | |
| 344, | |
| "rwse-free@3.0.0": | |
| 456, | |
| "rwse-free@3.1.0": | |
| 433, | |
| "rwse-free@3.1.1": | |
| 450, | |
| "rwse-free@4.0.0": | |
| 465, | |
| "rwse-free@4.1.0": | |
| 458, | |
| "rwse-free@5.0.0": | |
| 336, | |
| "rx@0.1.0": | |
| -49, | |
| "rx@0.2.0": | |
| -56, | |
| "rx@0.3.0": | |
| -78, | |
| "rx@0.4.0": | |
| 78, | |
| "rx@0.5.0": | |
| 84, | |
| "rx@0.6.0": | |
| 80, | |
| "rx@0.7.0": | |
| 95, | |
| "rx@0.7.1": | |
| 167, | |
| "rx@0.8.0": | |
| 70, | |
| "rx@0.8.1": | |
| 63, | |
| "rx@0.8.2": | |
| 82, | |
| "rx@0.9.0": | |
| 72, | |
| "rx@0.9.1": | |
| 72, | |
| "rx@1.0.0": | |
| 155, | |
| "rx@2.0.0": | |
| 459, | |
| "rx-state@0.1.0": | |
| 138, | |
| "rx-state@0.1.1": | |
| 61, | |
| "rx-state@0.2.0": | |
| 77, | |
| "rxjs@0.1.0": | |
| -324, | |
| "rxjs@0.1.1": | |
| -290, | |
| "rxjs@0.2.0": | |
| -296, | |
| "rxjs@0.3.0": | |
| 589, | |
| "rxjs@0.3.1": | |
| 583, | |
| "rxps@1.0.0": | |
| 682, | |
| "rxps@1.1.0": | |
| 555, | |
| "rxps@1.1.1": | |
| 567, | |
| "rxps@1.1.3": | |
| 574, | |
| "rxps@1.1.4": | |
| 574, | |
| "rxps@1.2.0": | |
| 716, | |
| "rxps@1.3.0": | |
| 556, | |
| "rxps@1.4.0": | |
| 568, | |
| "rxps@1.4.1": | |
| 567, | |
| "rxps@1.4.2": | |
| 578, | |
| "rxps@1.4.3": | |
| 574, | |
| "rxps@1.5.0": | |
| 578, | |
| "rxps@1.6.0": | |
| 716, | |
| "rxps@1.7.0": | |
| 553, | |
| "rxps@1.8.0": | |
| 137, | |
| "safe-coerce@0.0.1": | |
| 54, | |
| "safe-coerce@0.0.2": | |
| 75, | |
| "safe-coerce@1.0.0": | |
| 63, | |
| "safe-coerce@2.0.0": | |
| 68, | |
| "safe-printf@1.0.0": | |
| 117, | |
| "safelist@1.0.0": | |
| 306, | |
| "safelist@1.1.0": | |
| 280, | |
| "safelist@2.0.0": | |
| 85, | |
| "safelist@3.0.0": | |
| 89, | |
| "safely@1.0.1": | |
| 73, | |
| "safely@2.0.0": | |
| 302, | |
| "safely@3.0.0": | |
| 193, | |
| "safely@4.0.0": | |
| 99, | |
| "safely@4.0.1": | |
| 215, | |
| "sammy@0.1.0": | |
| 82, | |
| "sammy@1.0.0": | |
| 64, | |
| "sammy@2.0.0": | |
| 68, | |
| "sammy@3.0.0": | |
| 128, | |
| "scannable@0.1.0": | |
| 54, | |
| "school-of-music@1.1.1": | |
| 93, | |
| "school-of-music@1.2.0": | |
| 467, | |
| "school-of-music@1.2.1": | |
| 413, | |
| "school-of-music@1.2.2": | |
| 476, | |
| "school-of-music@1.2.3": | |
| 352, | |
| "school-of-music@1.2.4": | |
| 338, | |
| "school-of-music@1.3.0": | |
| 106, | |
| "screenfull@0.1.0": | |
| 373, | |
| "screeps-classy@0.2.0": | |
| 226, | |
| "screeps-classy@0.2.1": | |
| 227, | |
| "screeps-classy@1.1.0": | |
| 228, | |
| "screeps-classy@2.0.0": | |
| 332, | |
| "screeps-classy@2.1.0": | |
| 216, | |
| "screeps-classy@2.2.0": | |
| 224, | |
| "screeps-classy@2.3.0": | |
| 227, | |
| "screeps-classy@3.0.0": | |
| 333, | |
| "screeps-classy@3.0.1": | |
| 363, | |
| "scrypt@0.0.0": | |
| 563, | |
| "scrypt@0.0.1": | |
| 423, | |
| "scrypt@1.0.0": | |
| 244, | |
| "scrypt@1.0.1": | |
| 306, | |
| "sdom@0.1.0": | |
| 509, | |
| "sdom@0.1.1": | |
| 504, | |
| "sdom@0.1.2": | |
| 513, | |
| "sdom@0.1.3": | |
| 678, | |
| "sdom@0.1.4": | |
| 494, | |
| "sdom@1.0.0": | |
| 275, | |
| "search@0.1.0": | |
| 99, | |
| "search@0.2.0": | |
| -84, | |
| "search@0.3.0": | |
| 91, | |
| "search@0.4.0": | |
| 93, | |
| "search@0.5.0": | |
| 96, | |
| "search@0.6.0": | |
| 191, | |
| "search@0.7.0": | |
| 92, | |
| "search@0.7.1": | |
| 93, | |
| "search@0.7.2": | |
| 97, | |
| "search@1.0.0": | |
| 81, | |
| "search@2.0.0": | |
| 346, | |
| "search@3.0.0": | |
| 453, | |
| "search-trie@1.0.0": | |
| 119, | |
| "sec@0.1.0": | |
| 54, | |
| "sec@0.1.1": | |
| 81, | |
| "selda@0.1.0": | |
| 533, | |
| "selection-foldable@0.1.0": | |
| 160, | |
| "selection-foldable@0.1.1": | |
| 161, | |
| "selection-foldable@0.1.2": | |
| 163, | |
| "selection-foldable@0.1.3": | |
| 279, | |
| "selection-foldable@0.2.0": | |
| 153, | |
| "selective@0.1.0": | |
| 58, | |
| "selective@0.1.1": | |
| 108, | |
| "semigroups@0.0.1": | |
| 60, | |
| "semigroups@0.0.2": | |
| 72, | |
| "semigroups@0.0.4": | |
| 59, | |
| "semirings@0.2.0": | |
| 204, | |
| "semirings@1.0.0": | |
| 70, | |
| "semirings@2.0.0": | |
| 112, | |
| "semirings@3.0.0": | |
| 169, | |
| "semirings@4.0.0": | |
| 180, | |
| "semirings@5.0.0": | |
| 86, | |
| "semirings@6.0.0": | |
| 84, | |
| "semirings@7.0.0": | |
| 77, | |
| "sentry-raven@0.1.0": | |
| 763, | |
| "sentry-raven@0.1.1": | |
| 597, | |
| "sentry-raven@0.1.2": | |
| 614, | |
| "sentry-raven@0.2.0": | |
| 462, | |
| "sequences@0.0.2": | |
| 73, | |
| "sequences@0.1.0": | |
| 73, | |
| "sequences@0.2.0": | |
| 155, | |
| "sequences@0.2.1": | |
| 71, | |
| "sequences@0.3.0": | |
| 53, | |
| "sequences@0.3.1": | |
| 81, | |
| "sequences@0.4.0": | |
| 71, | |
| "sequences@0.4.1": | |
| 73, | |
| "sequences@0.4.2": | |
| 73, | |
| "sequences@0.4.3": | |
| 76, | |
| "sequences@0.5.0": | |
| 154, | |
| "sequences@0.6.0": | |
| 100, | |
| "sequences@1.0.0": | |
| 62, | |
| "sequences@1.0.1": | |
| 94, | |
| "sequences@1.0.2": | |
| 84, | |
| "sequences@1.0.3": | |
| 115, | |
| "sequences@2.0.0": | |
| 93, | |
| "sequences@2.1.0": | |
| 90, | |
| "sequences@3.0.0": | |
| 172, | |
| "sequences@3.0.2": | |
| 93, | |
| "servant-support@1.0.3": | |
| 77, | |
| "servant-support@1.0.4": | |
| 93, | |
| "servant-support@2.0.0": | |
| 94, | |
| "servant-support@2.0.1": | |
| 95, | |
| "servant-support@3.0.0": | |
| 91, | |
| "servant-support@3.0.1": | |
| 90, | |
| "servant-support@4.0.0": | |
| 177, | |
| "servant-support@5.0.0": | |
| 80, | |
| "servant-support@5.0.1": | |
| 402, | |
| "servant-support@6.0.0": | |
| -423, | |
| "servant-support@7.0.0": | |
| -411, | |
| "servant-support@8.0.0": | |
| 1017, | |
| "servant-support@9.0.1": | |
| 735, | |
| "servant-support-012@1.0.3": | |
| 179, | |
| "servant-support-012@1.0.4": | |
| 81, | |
| "servant-support-012@2.0.0": | |
| 75, | |
| "servant-support-012@2.0.1": | |
| 91, | |
| "servant-support-012@3.0.0": | |
| 95, | |
| "servant-support-012@3.0.1": | |
| 95, | |
| "servant-support-012@4.0.0": | |
| 91, | |
| "servant-support-012@5.0.0": | |
| 92, | |
| "servant-support-012@5.0.1": | |
| 508, | |
| "servant-support-012@6.0.0": | |
| -404, | |
| "servant-support-012@7.0.0": | |
| -399, | |
| "servant-support-012@8.0.0": | |
| 761, | |
| "servant-support-012@9.0.1": | |
| 729, | |
| "server-sent-events@0.1.0": | |
| 613, | |
| "server-sent-events@0.2.0": | |
| 198, | |
| "server-sent-events@0.3.0": | |
| 237, | |
| "server-sent-events@0.3.1": | |
| 111, | |
| "setimmediate@0.0.0": | |
| 49, | |
| "setimmediate@1.0.0": | |
| 71, | |
| "setimmediate@1.0.1": | |
| 68, | |
| "setimmediate@1.0.2": | |
| 68, | |
| "sets@0.1.0": | |
| -72, | |
| "sets@0.1.1": | |
| -75, | |
| "sets@0.1.2": | |
| -154, | |
| "sets@0.2.0": | |
| 85, | |
| "sets@0.3.0": | |
| 75, | |
| "sets@0.3.1": | |
| 92, | |
| "sets@0.3.2": | |
| 80, | |
| "sets@0.4.0": | |
| 82, | |
| "sets@0.4.1": | |
| 89, | |
| "sets@0.4.2": | |
| 92, | |
| "sets@0.5.0": | |
| 193, | |
| "sets@0.5.1": | |
| 78, | |
| "sets@0.5.2": | |
| 77, | |
| "sets@0.5.3": | |
| 85, | |
| "sets@0.5.4": | |
| 87, | |
| "sets@0.5.5": | |
| 95, | |
| "sets@0.5.6": | |
| 84, | |
| "sets@0.5.7": | |
| 169, | |
| "sets@1.0.0": | |
| 80, | |
| "sets@2.0.0": | |
| 170, | |
| "sets@2.0.1": | |
| 202, | |
| "sets@3.0.0": | |
| 221, | |
| "sets@3.1.0": | |
| 326, | |
| "sets@3.2.0": | |
| 326, | |
| "sets@3.2.1": | |
| 327, | |
| "sexp@0.0.1": | |
| 162, | |
| "sexp@0.1.0": | |
| 80, | |
| "sexp@0.2.0": | |
| 67, | |
| "sexp@0.2.1": | |
| 79, | |
| "sexp@0.2.2": | |
| 75, | |
| "sexp@1.0.0": | |
| 217, | |
| "sexp@2.0.0": | |
| 206, | |
| "sforce-remote-action@0.0.0": | |
| 512, | |
| "sforce-remote-action@1.0.0": | |
| 446, | |
| "sforce-remote-action@1.0.1": | |
| 362, | |
| "shoronpo@0.1.0": | |
| 155, | |
| "shoronpo@0.2.0": | |
| 150, | |
| "shoronpo@0.3.0": | |
| 152, | |
| "shoronpo@1.0.0": | |
| 103, | |
| "shortid@0.0.1": | |
| 63, | |
| "shortid@0.0.2": | |
| 127, | |
| "shortid@0.0.3": | |
| 60, | |
| "showdown@0.0.1": | |
| 52, | |
| "signal@1.0.0": | |
| 71, | |
| "signal@1.0.1": | |
| 61, | |
| "signal@1.0.2": | |
| 71, | |
| "signal@1.1.0": | |
| 94, | |
| "signal@1.2.0": | |
| 80, | |
| "signal@2.0.0": | |
| 145, | |
| "signal@2.0.1": | |
| 58, | |
| "signal@2.0.2": | |
| 51, | |
| "signal@2.1.0": | |
| 70, | |
| "signal@2.2.0": | |
| 65, | |
| "signal@2.2.2": | |
| 63, | |
| "signal@3.0.0": | |
| 72, | |
| "signal@4.0.0": | |
| 73, | |
| "signal@4.1.0": | |
| 133, | |
| "signal@4.1.1": | |
| 90, | |
| "signal@4.2.0": | |
| 100, | |
| "signal@5.0.0": | |
| 100, | |
| "signal@5.0.1": | |
| 100, | |
| "signal@5.1.0": | |
| 92, | |
| "signal@5.2.0": | |
| 85, | |
| "signal@6.0.0": | |
| 79, | |
| "signal@6.1.0": | |
| 179, | |
| "signal@7.0.0": | |
| -206, | |
| "signal@8.0.0": | |
| -244, | |
| "signal@8.0.1": | |
| -340, | |
| "signal@8.1.0": | |
| 458, | |
| "signal@9.0.0": | |
| 421, | |
| "signal@10.0.0": | |
| 302, | |
| "signal@10.1.0": | |
| 196, | |
| "signal@11.0.0": | |
| 285, | |
| "signal@11.0.1": | |
| 299, | |
| "signal@11.0.2": | |
| 299, | |
| "signal@11.0.3": | |
| 202, | |
| "signal@12.0.1": | |
| 110, | |
| "signal@13.0.0": | |
| 96, | |
| "signal-aff@0.0.1": | |
| -545, | |
| "signal-loop@1.0.1": | |
| 60, | |
| "signal-loop@2.0.0": | |
| 431, | |
| "signal-socket@1.0.0": | |
| -77, | |
| "signal-socket@1.1.0": | |
| 83, | |
| "signal-socket@2.0.0": | |
| 76, | |
| "signal-socket@3.0.0": | |
| 533, | |
| "signal-time-travel@1.0.0": | |
| -382, | |
| "signal-time-travel@1.1.0": | |
| -325, | |
| "signature-pad@0.1.0": | |
| 79, | |
| "signature-pad@0.2.0": | |
| 91, | |
| "signature-pad@0.3.0": | |
| -321, | |
| "signature-pad@0.4.0": | |
| -215, | |
| "signature-pad@1.0.0": | |
| 500, | |
| "signature-pad-halogen@0.1.0": | |
| -267, | |
| "signature-pad-halogen@0.2.0": | |
| -265, | |
| "signature-pad-halogen@0.3.0": | |
| -275, | |
| "signature-pad-halogen@1.0.0": | |
| -738, | |
| "signature-pad-halogen@1.0.1": | |
| -853, | |
| "signature-pad-halogen@2.0.0": | |
| -691, | |
| "sijidou@0.1.0": | |
| 74, | |
| "sijidou@1.0.0": | |
| 88, | |
| "simple-ajax@0.1.0": | |
| 475, | |
| "simple-ajax@0.2.0": | |
| 480, | |
| "simple-ajax@0.3.0": | |
| 475, | |
| "simple-ajax@0.4.0": | |
| 566, | |
| "simple-ajax@0.4.1": | |
| 463, | |
| "simple-ajax@0.5.0": | |
| 452, | |
| "simple-ajax@1.0.0": | |
| 551, | |
| "simple-ajax@2.0.0": | |
| 433, | |
| "simple-ajax@3.0.0": | |
| 434, | |
| "simple-ajax@4.0.0": | |
| 188, | |
| "simple-assert@0.1.0": | |
| 56, | |
| "simple-assert@0.2.0": | |
| 79, | |
| "simple-assert@0.2.1": | |
| 73, | |
| "simple-assert@0.3.0": | |
| 137, | |
| "simple-child-process@0.1.0": | |
| 439, | |
| "simple-csv@0.1.0": | |
| 132, | |
| "simple-csv@0.2.0": | |
| 137, | |
| "simple-datetime@0.1.0": | |
| 368, | |
| "simple-datetime@0.1.1": | |
| 368, | |
| "simple-dom@0.0.2": | |
| 164, | |
| "simple-dom@0.0.3": | |
| 91, | |
| "simple-dom@0.0.4": | |
| 63, | |
| "simple-dom@0.1.0": | |
| 93, | |
| "simple-dom@0.1.1": | |
| 104, | |
| "simple-dom@0.1.2": | |
| 102, | |
| "simple-dom@0.1.3": | |
| 127, | |
| "simple-emitter@0.1.0": | |
| 212, | |
| "simple-emitter@0.1.1": | |
| 305, | |
| "simple-emitter@0.1.2": | |
| 195, | |
| "simple-emitter@0.2.0": | |
| 194, | |
| "simple-emitter@1.0.0": | |
| 125, | |
| "simple-emitter@2.0.0": | |
| 100, | |
| "simple-emitter@3.0.0": | |
| 86, | |
| "simple-emitter@3.0.1": | |
| 82, | |
| "simple-i18n@0.1.0": | |
| 111, | |
| "simple-i18n@0.1.1": | |
| 253, | |
| "simple-i18n@0.1.2": | |
| 111, | |
| "simple-i18n@1.0.0": | |
| 84, | |
| "simple-i18n@2.0.0": | |
| 91, | |
| "simple-i18n@2.0.1": | |
| 85, | |
| "simple-json@0.1.0": | |
| 378, | |
| "simple-json@0.2.0": | |
| 368, | |
| "simple-json@0.3.0": | |
| 372, | |
| "simple-json@0.4.0": | |
| 495, | |
| "simple-json@0.5.0": | |
| 350, | |
| "simple-json@0.6.0": | |
| 350, | |
| "simple-json@0.7.0": | |
| 358, | |
| "simple-json@0.8.0": | |
| 360, | |
| "simple-json@0.9.0": | |
| 363, | |
| "simple-json@0.10.0": | |
| 345, | |
| "simple-json@1.0.0": | |
| 436, | |
| "simple-json@1.1.0": | |
| 251, | |
| "simple-json@2.0.0": | |
| 242, | |
| "simple-json@2.0.1": | |
| 254, | |
| "simple-json@3.0.0": | |
| 248, | |
| "simple-json@4.0.0": | |
| 142, | |
| "simple-json@4.1.0": | |
| 223, | |
| "simple-json@4.2.0": | |
| 136, | |
| "simple-json@4.3.0": | |
| 126, | |
| "simple-json@4.4.0": | |
| 141, | |
| "simple-json@4.4.1": | |
| 145, | |
| "simple-json@5.0.0": | |
| 144, | |
| "simple-json@5.1.0": | |
| 144, | |
| "simple-json@6.0.0": | |
| 142, | |
| "simple-json@7.0.0": | |
| 268, | |
| "simple-json@8.0.0": | |
| 99, | |
| "simple-json@9.0.0": | |
| 86, | |
| "simple-json-generics@0.1.0": | |
| 198, | |
| "simple-json-utils@0.1.0": | |
| 249, | |
| "simple-jwt@1.0.0": | |
| 167, | |
| "simple-jwt@1.0.1": | |
| 161, | |
| "simple-jwt@1.0.2": | |
| 158, | |
| "simple-jwt@1.0.3": | |
| 293, | |
| "simple-jwt@1.1.0": | |
| 145, | |
| "simple-jwt@1.1.1": | |
| 161, | |
| "simple-jwt@2.0.0": | |
| 159, | |
| "simple-jwt@3.0.0": | |
| 117, | |
| "simple-jwt@3.1.0": | |
| 139, | |
| "simple-jwt@4.0.0": | |
| 111, | |
| "simple-jwt@4.0.1": | |
| 254, | |
| "simple-moment@0.1.0": | |
| 56, | |
| "simple-moment@0.2.0": | |
| 68, | |
| "simple-moment@0.2.1": | |
| 79, | |
| "simple-moment@0.2.2": | |
| 75, | |
| "simple-moment@0.3.0": | |
| 79, | |
| "simple-moment@0.4.0": | |
| 162, | |
| "simple-moment@0.5.0": | |
| 160, | |
| "simple-parser@1.0.0": | |
| 145, | |
| "simple-parser@2.0.0": | |
| 64, | |
| "simple-parser@2.1.0": | |
| 75, | |
| "simple-parser@2.2.0": | |
| 73, | |
| "simple-parser@3.0.0": | |
| 77, | |
| "simple-parser@4.0.0": | |
| 75, | |
| "simple-parser@4.1.0": | |
| 162, | |
| "simple-parser@5.0.0": | |
| 88, | |
| "simple-parser@5.1.0": | |
| 69, | |
| "simple-parser@5.1.1": | |
| 72, | |
| "simple-parser@6.0.0": | |
| 67, | |
| "simple-parser@6.0.1": | |
| 86, | |
| "simple-parser@7.0.0": | |
| 175, | |
| "simple-parser@8.0.0": | |
| 152, | |
| "simple-repl@1.0.0": | |
| 235, | |
| "simple-repl@2.0.0": | |
| 113, | |
| "simple-repl@2.1.0": | |
| 76, | |
| "simple-repl@3.0.0": | |
| 732, | |
| "simple-repl@4.0.0": | |
| 741, | |
| "simple-repl@4.0.1": | |
| 740, | |
| "simple-repl@5.0.0": | |
| 759, | |
| "simple-repl@6.0.0": | |
| 578, | |
| "simple-repl@6.0.1": | |
| 392, | |
| "simple-request@3.1.0": | |
| 80, | |
| "simple-request@3.1.1": | |
| 83, | |
| "simple-request@4.0.0": | |
| 85, | |
| "simple-timestamp@1.0.0": | |
| 406, | |
| "simple-timestamp@1.1.0": | |
| 535, | |
| "simple-timestamp@1.2.0": | |
| 388, | |
| "simple-timestamp@1.3.0": | |
| 395, | |
| "simple-timestamp@2.0.0": | |
| 397, | |
| "simple-timestamp@3.0.0": | |
| 405, | |
| "simple-ulid@1.0.0": | |
| 161, | |
| "simple-ulid@2.0.0": | |
| 206, | |
| "simple-ulid@3.0.0": | |
| 84, | |
| "simplecrypto@0.0.1": | |
| 43, | |
| "simplecrypto@0.0.2": | |
| 80, | |
| "simplecrypto@0.0.3": | |
| 70, | |
| "simplecrypto@0.0.4": | |
| 74, | |
| "simplecrypto@0.0.5": | |
| 70, | |
| "simplecrypto@0.0.6": | |
| 78, | |
| "simplecrypto@0.0.7": | |
| 99, | |
| "simplecrypto@0.0.8": | |
| 119, | |
| "simplecrypto@0.1.0": | |
| 49, | |
| "simplecrypto@1.0.0": | |
| 68, | |
| "simplecrypto@1.0.1": | |
| 67, | |
| "sized-matrices@0.1.0": | |
| 110, | |
| "sized-matrices@0.1.1": | |
| 104, | |
| "sized-matrices@0.2.0": | |
| 144, | |
| "sized-matrices@0.2.1": | |
| 174, | |
| "sized-matrices@1.0.0": | |
| 547, | |
| "sized-vectors@1.0.0": | |
| 62, | |
| "sized-vectors@1.1.0": | |
| 87, | |
| "sized-vectors@2.0.0": | |
| 112, | |
| "sized-vectors@2.1.0": | |
| 114, | |
| "sized-vectors@2.2.0": | |
| 112, | |
| "sized-vectors@3.0.0": | |
| 197, | |
| "sized-vectors@3.1.0": | |
| 85, | |
| "sized-vectors@4.0.0": | |
| 84, | |
| "sized-vectors@5.0.0": | |
| 335, | |
| "sized-vectors@5.0.1": | |
| 302, | |
| "sized-vectors@5.0.2": | |
| 303, | |
| "sjcl@0.0.0": | |
| 147, | |
| "sjcl@0.0.1": | |
| 558, | |
| "sketch@1.0.0": | |
| 295, | |
| "sketch@1.1.0": | |
| 289, | |
| "sketch@1.1.1": | |
| 301, | |
| "sketch@1.2.0": | |
| 302, | |
| "sketch@1.2.2": | |
| 356, | |
| "sketch@1.3.0": | |
| 357, | |
| "skull@0.0.1": | |
| -162, | |
| "skull@0.0.2": | |
| -293, | |
| "skull@0.0.3": | |
| -153, | |
| "skull@0.0.4": | |
| -154, | |
| "skull@0.0.5": | |
| -161, | |
| "skull@0.0.6": | |
| -162, | |
| "skull@0.0.7": | |
| -162, | |
| "skull@0.0.8": | |
| -161, | |
| "skull@0.0.9": | |
| -249, | |
| "skull@0.0.10": | |
| -145, | |
| "skull@0.0.11": | |
| -156, | |
| "slamdown-smolder@1.0.0": | |
| -507, | |
| "slamdown-smolder@1.1.0": | |
| -500, | |
| "slamdown-smolder@1.2.0": | |
| -619, | |
| "slamdown-smolder@1.3.0": | |
| -478, | |
| "slamdown-smolder@2.0.0": | |
| 287, | |
| "slamdown-smolder@2.0.1": | |
| 299, | |
| "slices@0.1.0": | |
| 94, | |
| "slices@0.1.1": | |
| 97, | |
| "slices@0.2.0": | |
| 95, | |
| "slides@0.5.0": | |
| -498, | |
| "slug@0.1.0": | |
| 406, | |
| "slug@0.2.0": | |
| 217, | |
| "slug@1.0.0": | |
| 204, | |
| "slug@2.0.0": | |
| 173, | |
| "slug@3.0.0": | |
| 117, | |
| "slug@3.0.1": | |
| 2592, | |
| "slug@3.0.2": | |
| 97, | |
| "slug@3.0.3": | |
| 98, | |
| "slug@3.0.4": | |
| 110, | |
| "slug@3.0.5": | |
| 113, | |
| "slug@3.0.6": | |
| 110, | |
| "slug@3.0.7": | |
| 109, | |
| "slug@3.0.8": | |
| 111, | |
| "small-ffi@1.0.0": | |
| 126, | |
| "small-ffi@1.0.1": | |
| 49, | |
| "small-ffi@1.0.2": | |
| 56, | |
| "small-ffi@2.0.0": | |
| 71, | |
| "small-ffi@2.1.0": | |
| 66, | |
| "small-ffi@2.1.2": | |
| 68, | |
| "small-ffi@4.0.1": | |
| 133, | |
| "smash@1.0.0": | |
| 543, | |
| "smash@1.1.0": | |
| 394, | |
| "smash@2.0.0": | |
| 393, | |
| "smash@3.0.0": | |
| 179, | |
| "smolder@1.0.0": | |
| -66, | |
| "smolder@1.0.1": | |
| -73, | |
| "smolder@1.0.2": | |
| -71, | |
| "smolder@2.0.0": | |
| -67, | |
| "smolder@3.0.0": | |
| 173, | |
| "smolder@3.0.1": | |
| 69, | |
| "smolder@4.0.0": | |
| 61, | |
| "smolder@4.0.1": | |
| 75, | |
| "smolder@5.0.0": | |
| 72, | |
| "smolder@6.0.0": | |
| 175, | |
| "smolder@6.0.1": | |
| 170, | |
| "smolder@7.0.0": | |
| 328, | |
| "smolder@8.0.0": | |
| 201, | |
| "smolder@9.0.0": | |
| 218, | |
| "smolder@10.0.0": | |
| 245, | |
| "smolder@10.1.0": | |
| 241, | |
| "smolder@10.2.0": | |
| 242, | |
| "smolder@11.0.0": | |
| 251, | |
| "smolder@11.0.1": | |
| 171, | |
| "smolder@12.0.0": | |
| 136, | |
| "smolder@12.1.0": | |
| 136, | |
| "smolder@12.2.0": | |
| 131, | |
| "smolder@12.3.0": | |
| 132, | |
| "smolder-dom@1.0.0": | |
| 691, | |
| "smolder-dom@1.1.0": | |
| 684, | |
| "smolder-dom@2.0.0": | |
| 642, | |
| "smolder-dom@3.0.0": | |
| 309, | |
| "smolder-idom@0.1.0": | |
| 446, | |
| "smolder-idom@0.1.1": | |
| 449, | |
| "smolder-idom@0.1.2": | |
| 450, | |
| "smolder-idom@0.1.3": | |
| 452, | |
| "smolder-vdom@1.0.0": | |
| -601, | |
| "smsapi@0.1.1": | |
| 264, | |
| "snabbdom@0.2.1": | |
| -306, | |
| "snabbdom@0.2.2": | |
| -322, | |
| "snabbdom@0.2.3": | |
| -315, | |
| "snabbdom@1.0.0": | |
| 728, | |
| "snabbdom@1.0.1": | |
| 366, | |
| "snail@2.0.0": | |
| 79, | |
| "snail@3.0.0": | |
| 431, | |
| "snail@3.1.0": | |
| 441, | |
| "snail@4.0.0": | |
| 424, | |
| "socketio@0.0.2": | |
| -56, | |
| "socketio-2@1.0.0": | |
| 160, | |
| "socketio-2@1.1.0": | |
| 150, | |
| "sockjs-client@0.1.1": | |
| 118, | |
| "sockjs-node@0.1.0": | |
| 656, | |
| "sockjs-node@0.1.1": | |
| 606, | |
| "sodium@0.0.1": | |
| 404, | |
| "sodium@0.0.2": | |
| 283, | |
| "sodium@1.0.0": | |
| 401, | |
| "sodium@2.0.0": | |
| 541, | |
| "sodium@2.1.0": | |
| 262, | |
| "solc@1.0.0": | |
| 765, | |
| "solc@1.1.0": | |
| 797, | |
| "son-of-a-j@0.1.0": | |
| 523, | |
| "son-of-a-j@0.1.1": | |
| 526, | |
| "son-of-a-j@0.2.0": | |
| 524, | |
| "son-of-a-j@0.2.1": | |
| 652, | |
| "son-of-a-j@0.2.2": | |
| 512, | |
| "sorted-arrays@0.0.1": | |
| 82, | |
| "sorted-arrays@0.1.0": | |
| 95, | |
| "sorted-arrays@0.1.1": | |
| 93, | |
| "sorted-arrays@0.1.3": | |
| 93, | |
| "sorted-arrays@0.1.4": | |
| 186, | |
| "sorted-arrays@0.1.5": | |
| 97, | |
| "sorted-arrays@0.2.0": | |
| 73, | |
| "soundfonts@1.1.5": | |
| 776, | |
| "soundfonts@1.2.0": | |
| 695, | |
| "soundfonts@2.0.0": | |
| 695, | |
| "soundfonts@3.0.0": | |
| 492, | |
| "soundfonts@3.0.1": | |
| 622, | |
| "soundfonts@3.0.2": | |
| 479, | |
| "soundfonts@3.1.1": | |
| 456, | |
| "soundfonts@3.2.0": | |
| 325, | |
| "soundfonts@3.3.0": | |
| 191, | |
| "soundfonts@4.0.1": | |
| 162, | |
| "soundfonts@4.1.0": | |
| 162, | |
| "sparkle@0.1.0": | |
| -196, | |
| "sparkle@0.1.1": | |
| -128, | |
| "sparkle@0.2.0": | |
| -104, | |
| "sparkle@0.2.1": | |
| -117, | |
| "sparkle@0.2.2": | |
| -128, | |
| "sparkle@0.3.0": | |
| -135, | |
| "sparkle@0.3.1": | |
| -134, | |
| "sparkle@1.0.0": | |
| 248, | |
| "sparkle@1.0.1": | |
| 344, | |
| "sparkle@2.0.0": | |
| -690, | |
| "sparkle@3.0.0": | |
| 730, | |
| "sparkle@4.0.0": | |
| 639, | |
| "sparkle@4.1.0": | |
| 630, | |
| "sparkle@4.1.1": | |
| 633, | |
| "sparkle@4.2.0": | |
| 711, | |
| "sparrow@0.0.6": | |
| 598, | |
| "sparrow-queue@0.0.5": | |
| 772, | |
| "sparse-matrices@1.0.0": | |
| 184, | |
| "sparse-matrices@1.1.0": | |
| 187, | |
| "sparse-matrices@1.2.0": | |
| 186, | |
| "sparse-matrices@1.2.1": | |
| 149, | |
| "sparse-polynomials@1.0.0": | |
| 227, | |
| "sparse-polynomials@1.0.1": | |
| 116, | |
| "sparse-polynomials@1.0.2": | |
| 114, | |
| "sparse-polynomials@1.0.3": | |
| 124, | |
| "sparse-polynomials@1.0.4": | |
| 84, | |
| "sparse-polynomials@1.0.5": | |
| 81, | |
| "spec@0.4.0": | |
| 70, | |
| "spec@0.5.0": | |
| 150, | |
| "spec@0.5.1": | |
| 79, | |
| "spec@0.5.2": | |
| 64, | |
| "spec@0.6.0": | |
| 91, | |
| "spec@0.6.1": | |
| 88, | |
| "spec@0.6.2": | |
| 179, | |
| "spec@0.7.0": | |
| 85, | |
| "spec@0.7.1": | |
| 70, | |
| "spec@0.7.2": | |
| 86, | |
| "spec@0.7.3": | |
| 85, | |
| "spec@0.8.0": | |
| 74, | |
| "spec@0.9.0": | |
| 436, | |
| "spec@0.9.1": | |
| 507, | |
| "spec@0.10.0": | |
| 434, | |
| "spec@0.11.0": | |
| -348, | |
| "spec@0.12.0": | |
| -372, | |
| "spec@0.12.1": | |
| -375, | |
| "spec@0.12.2": | |
| -372, | |
| "spec@0.12.3": | |
| -459, | |
| "spec@0.12.4": | |
| -634, | |
| "spec@0.13.0": | |
| 522, | |
| "spec@0.14.0": | |
| 464, | |
| "spec@1.0.0": | |
| -479, | |
| "spec@2.0.0": | |
| -298, | |
| "spec@3.0.0": | |
| 310, | |
| "spec@3.1.0": | |
| 308, | |
| "spec@3.1.1": | |
| 412, | |
| "spec@4.0.0": | |
| 295, | |
| "spec@4.0.1": | |
| 285, | |
| "spec@5.0.0": | |
| 134, | |
| "spec@5.0.1": | |
| 141, | |
| "spec@6.0.0": | |
| 310, | |
| "spec@7.0.0": | |
| 109, | |
| "spec@7.1.0": | |
| 109, | |
| "spec-discovery@0.1.0": | |
| -531, | |
| "spec-discovery@0.2.0": | |
| 581, | |
| "spec-discovery@0.3.0": | |
| -499, | |
| "spec-discovery@0.4.0": | |
| -464, | |
| "spec-discovery@0.5.0": | |
| 593, | |
| "spec-discovery@0.6.0": | |
| 574, | |
| "spec-discovery@1.0.0": | |
| -573, | |
| "spec-discovery@2.0.0": | |
| -414, | |
| "spec-discovery@3.0.0": | |
| 367, | |
| "spec-discovery@3.1.0": | |
| 368, | |
| "spec-discovery@3.2.0": | |
| 363, | |
| "spec-discovery@4.0.0": | |
| 364, | |
| "spec-discovery@5.0.0": | |
| 500, | |
| "spec-discovery@6.0.0": | |
| 154, | |
| "spec-discovery@7.0.0": | |
| -266, | |
| "spec-discovery@8.0.0": | |
| 152, | |
| "spec-discovery@8.0.1": | |
| 152, | |
| "spec-mocha@0.2.0": | |
| 534, | |
| "spec-mocha@0.3.0": | |
| -551, | |
| "spec-mocha@0.3.1": | |
| -481, | |
| "spec-mocha@0.4.0": | |
| -508, | |
| "spec-mocha@1.0.0": | |
| -452, | |
| "spec-mocha@2.0.0": | |
| -400, | |
| "spec-mocha@3.0.0": | |
| 396, | |
| "spec-mocha@4.0.0": | |
| 18562, | |
| "spec-quickcheck@0.1.0": | |
| -66, | |
| "spec-quickcheck@0.1.1": | |
| -168, | |
| "spec-quickcheck@0.2.0": | |
| 99, | |
| "spec-quickcheck@0.2.1": | |
| 66, | |
| "spec-quickcheck@0.3.0": | |
| 111, | |
| "spec-quickcheck@0.9.1": | |
| 89, | |
| "spec-quickcheck@0.10.0": | |
| -477, | |
| "spec-quickcheck@1.0.0": | |
| -526, | |
| "spec-quickcheck@2.0.0": | |
| -314, | |
| "spec-quickcheck@3.0.0": | |
| 434, | |
| "spec-quickcheck@3.1.0": | |
| 323, | |
| "spec-quickcheck@4.0.0": | |
| 158, | |
| "spec-quickcheck@5.0.0": | |
| 130, | |
| "spec-reporter-xunit@0.1.1": | |
| 92, | |
| "spec-reporter-xunit@0.2.0": | |
| 241, | |
| "spec-reporter-xunit@0.3.0": | |
| -438, | |
| "spec-reporter-xunit@0.3.1": | |
| -426, | |
| "spec-reporter-xunit@0.4.0": | |
| -356, | |
| "spec-reporter-xunit@0.5.0": | |
| 387, | |
| "specular@0.2.0": | |
| 253, | |
| "specular@0.5.0": | |
| 258, | |
| "specular@0.5.1": | |
| 356, | |
| "specular@0.5.2": | |
| 248, | |
| "specular@0.6.0": | |
| 250, | |
| "specular@0.6.1": | |
| 265, | |
| "specular@0.6.2": | |
| 263, | |
| "specular@0.7.0": | |
| 268, | |
| "specular@0.8.0": | |
| 367, | |
| "specular@0.8.1": | |
| 242, | |
| "specular@0.8.2": | |
| 252, | |
| "specular@0.8.3": | |
| 266, | |
| "specular@0.9.0": | |
| 261, | |
| "specular@0.9.1": | |
| 258, | |
| "specular@0.10.0": | |
| 397, | |
| "specular@0.10.1": | |
| 245, | |
| "specular@0.10.2": | |
| 240, | |
| "specular@0.11.0": | |
| 256, | |
| "specular@0.12.0": | |
| 443, | |
| "specular@0.12.1": | |
| 444, | |
| "split@0.1.0": | |
| 103, | |
| "split@0.2.0": | |
| 217, | |
| "splitmix@1.0.0": | |
| 99, | |
| "splitmix@2.0.0": | |
| 102, | |
| "splitmix@2.1.0": | |
| 105, | |
| "spork@0.1.0": | |
| 527, | |
| "spork@0.2.0": | |
| 502, | |
| "spork@0.3.0": | |
| 503, | |
| "spork@0.3.1": | |
| 632, | |
| "spork@0.3.2": | |
| 485, | |
| "spork@0.3.3": | |
| 480, | |
| "spork@0.3.4": | |
| 490, | |
| "spork@0.4.0": | |
| 495, | |
| "spork@0.5.0": | |
| 480, | |
| "spork@0.6.0": | |
| 499, | |
| "spork@1.0.0": | |
| 662, | |
| "sql@0.1.0": | |
| 85, | |
| "sql-squared@0.1.0": | |
| -518, | |
| "sql-squared@0.2.0": | |
| -531, | |
| "sql-squared@0.3.0": | |
| -530, | |
| "sql-squared@0.4.0": | |
| 1124, | |
| "sql-squared@0.4.1": | |
| 1225, | |
| "sql-squared@0.5.0": | |
| 1090, | |
| "sql-squared@0.6.0": | |
| 1093, | |
| "sql-squared@0.6.1": | |
| 1106, | |
| "sql-squared@0.6.2": | |
| 1127, | |
| "sql-squared@0.7.0": | |
| 870, | |
| "sql-squared@0.7.1": | |
| 1003, | |
| "sql-squared@0.7.2": | |
| 837, | |
| "sql-squared@0.7.3": | |
| 856, | |
| "sql-squared@0.7.4": | |
| 865, | |
| "sql-squared@0.7.5": | |
| 879, | |
| "sql-squared@0.8.0": | |
| 1220, | |
| "sql-squared@0.8.1": | |
| 1065, | |
| "sql-squared@0.8.2": | |
| 1073, | |
| "sql-squared@0.8.3": | |
| 1085, | |
| "sql-squared@0.8.4": | |
| 1086, | |
| "sql-squared@0.9.0": | |
| 1205, | |
| "sql-squared@0.9.1": | |
| 1053, | |
| "sql-squared@0.10.0": | |
| 1059, | |
| "sql-squared@0.10.1": | |
| 1068, | |
| "sql-squared@0.11.0": | |
| 1014, | |
| "sql-squared@0.12.0": | |
| 460, | |
| "sql-squared@0.13.0": | |
| 306, | |
| "sql-squared@14.0.0": | |
| 361, | |
| "sql-squared@14.1.0": | |
| 378, | |
| "sql-squared@15.0.0": | |
| 149, | |
| "sqlite@0.1.0": | |
| 84, | |
| "sqlite@0.1.1": | |
| 82, | |
| "sqlite@0.1.2": | |
| 87, | |
| "sqlite@1.0.0": | |
| -345, | |
| "sqlite@2.0.0": | |
| -284, | |
| "sqlite@3.0.0": | |
| 382, | |
| "ssh2-sftp-client@0.1.0": | |
| 289, | |
| "ssrs@1.0.0": | |
| 92, | |
| "st@0.1.0": | |
| 113, | |
| "st@0.1.1": | |
| 48, | |
| "st@1.0.0": | |
| 53, | |
| "st@2.0.0": | |
| 80, | |
| "st@3.0.0": | |
| 81, | |
| "st@4.0.0": | |
| 97, | |
| "st@4.0.1": | |
| 86, | |
| "st@4.0.2": | |
| 181, | |
| "st@4.1.0": | |
| 87, | |
| "st@4.1.1": | |
| 66, | |
| "st@5.0.0": | |
| 74, | |
| "st@5.0.1": | |
| 71, | |
| "st@6.0.0": | |
| 76, | |
| "st@6.1.0": | |
| 76, | |
| "st@6.2.0": | |
| 142, | |
| "st-lazy-ref@0.0.1": | |
| 57, | |
| "stac@0.1.0": | |
| 520, | |
| "stac@0.1.1": | |
| 486, | |
| "stac@0.1.2": | |
| 485, | |
| "stac@1.0.0": | |
| 1475, | |
| "stac@1.0.1": | |
| 1326, | |
| "stac@2.0.0": | |
| 226, | |
| "stack@1.0.0": | |
| 80, | |
| "stackless@0.0.4": | |
| 79, | |
| "stackless@0.0.5": | |
| 76, | |
| "stackless-cont@0.0.3": | |
| 79, | |
| "stacksafe-function@1.0.0": | |
| 65, | |
| "stacksafe-function@1.0.1": | |
| 122, | |
| "stacksafe-function@2.0.0": | |
| 44, | |
| "stalling-coroutines@0.1.0": | |
| 106, | |
| "stalling-coroutines@0.1.1": | |
| 104, | |
| "stalling-coroutines@1.0.0": | |
| 79, | |
| "stalling-coroutines@2.0.0": | |
| 146, | |
| "stalling-coroutines@3.0.0": | |
| 186, | |
| "stat-mode@1.0.0": | |
| 160, | |
| "static-serve@0.1.0": | |
| 432, | |
| "static-serve@0.1.1": | |
| 433, | |
| "static-serve@0.2.0": | |
| 425, | |
| "static-serve@0.2.1": | |
| 427, | |
| "static-serve@1.0.0": | |
| 397, | |
| "statistics@0.1.0": | |
| 70, | |
| "statistics@0.1.1": | |
| 73, | |
| "statistics@0.1.2": | |
| 87, | |
| "statistics@0.2.0": | |
| 60, | |
| "stats@0.0.2": | |
| 119, | |
| "stats@0.1.0": | |
| 114, | |
| "stats@0.2.0": | |
| 199, | |
| "stdout@0.1.0": | |
| 534, | |
| "stdout@0.1.1": | |
| 390, | |
| "stdout@0.2.0": | |
| 880, | |
| "stdout@1.0.0": | |
| 150, | |
| "storable@0.0.1": | |
| 245, | |
| "storable@0.0.3": | |
| 241, | |
| "storable@0.0.4": | |
| 241, | |
| "storable@0.0.5": | |
| 243, | |
| "storable@0.0.6": | |
| 447, | |
| "store@0.0.0": | |
| 229, | |
| "store@1.0.0": | |
| 222, | |
| "store@1.0.1": | |
| 228, | |
| "stream@0.1.0": | |
| 62, | |
| "stream@0.2.0": | |
| 148, | |
| "strictlypositiveint@1.0.0": | |
| 51, | |
| "strictlypositiveint@1.0.1": | |
| 52, | |
| "string-parsers@0.2.0": | |
| -72, | |
| "string-parsers@0.3.0": | |
| 78, | |
| "string-parsers@0.4.0": | |
| 84, | |
| "string-parsers@0.4.1": | |
| 76, | |
| "string-parsers@0.5.0": | |
| 71, | |
| "string-parsers@0.6.0": | |
| 161, | |
| "string-parsers@0.6.1": | |
| 78, | |
| "string-parsers@0.6.2": | |
| 58, | |
| "string-parsers@0.6.3": | |
| 91, | |
| "string-parsers@0.6.4": | |
| 75, | |
| "string-parsers@0.6.5": | |
| 75, | |
| "string-parsers@0.6.6": | |
| 75, | |
| "string-parsers@0.6.7": | |
| 104, | |
| "string-parsers@1.0.0": | |
| 113, | |
| "string-parsers@1.0.1": | |
| 49, | |
| "string-parsers@2.0.0": | |
| 155, | |
| "string-parsers@2.0.1": | |
| 159, | |
| "string-parsers@2.1.0": | |
| 147, | |
| "string-parsers@2.2.0": | |
| 145, | |
| "string-parsers@3.0.0": | |
| 211, | |
| "string-parsers@3.0.1": | |
| 292, | |
| "string-parsers@3.1.0": | |
| 280, | |
| "string-parsers@4.0.0": | |
| 126, | |
| "string-parsers@4.0.1": | |
| 125, | |
| "string-parsers@5.0.0": | |
| 136, | |
| "string-parsers@5.0.1": | |
| 137, | |
| "string-parsers@6.0.0": | |
| 94, | |
| "string-parsers@6.0.1": | |
| 181, | |
| "string-parsers@7.0.0": | |
| 81, | |
| "string-parsers@8.0.0": | |
| 72, | |
| "stringcolors@0.1.0": | |
| 51, | |
| "stringcolors@0.1.1": | |
| 71, | |
| "strings@0.1.0": | |
| 67, | |
| "strings@0.1.1": | |
| 68, | |
| "strings@0.1.2": | |
| 68, | |
| "strings@0.1.3": | |
| 68, | |
| "strings@0.2.0": | |
| 104, | |
| "strings@0.2.1": | |
| 43, | |
| "strings@0.3.0": | |
| 57, | |
| "strings@0.3.1": | |
| 66, | |
| "strings@0.3.2": | |
| 69, | |
| "strings@0.3.3": | |
| 134, | |
| "strings@0.4.0": | |
| 48, | |
| "strings@0.4.1": | |
| 53, | |
| "strings@0.4.2": | |
| 67, | |
| "strings@0.4.3": | |
| 67, | |
| "strings@0.4.4": | |
| 78, | |
| "strings@0.4.5": | |
| 67, | |
| "strings@0.5.0": | |
| 144, | |
| "strings@0.5.1": | |
| 74, | |
| "strings@0.5.2": | |
| 48, | |
| "strings@0.5.3": | |
| 81, | |
| "strings@0.5.4": | |
| 71, | |
| "strings@0.5.5": | |
| 63, | |
| "strings@0.6.0": | |
| 75, | |
| "strings@0.7.0": | |
| 75, | |
| "strings@0.7.1": | |
| 116, | |
| "strings@1.0.0": | |
| 98, | |
| "strings@1.1.0": | |
| 45, | |
| "strings@2.0.0": | |
| 68, | |
| "strings@2.0.1": | |
| 78, | |
| "strings@2.0.2": | |
| 77, | |
| "strings@2.1.0": | |
| 77, | |
| "strings@3.0.0": | |
| 69, | |
| "strings@3.1.0": | |
| 119, | |
| "strings@3.2.0": | |
| 197, | |
| "strings@3.2.1": | |
| 103, | |
| "strings@3.3.0": | |
| 119, | |
| "strings@3.3.1": | |
| 116, | |
| "strings@3.3.2": | |
| 121, | |
| "strings@3.4.0": | |
| 119, | |
| "strings@3.5.0": | |
| 206, | |
| "strings@4.0.0": | |
| 111, | |
| "strings@4.0.1": | |
| 97, | |
| "strings@4.0.2": | |
| 103, | |
| "strings@5.0.0": | |
| 93, | |
| "strings@6.0.0": | |
| 85, | |
| "strings@6.0.1": | |
| 89, | |
| "strings-extra@1.0.0": | |
| 150, | |
| "strings-extra@1.0.1": | |
| 232, | |
| "strings-extra@2.0.0": | |
| 137, | |
| "strings-extra@2.1.0": | |
| 119, | |
| "strings-extra@2.2.0": | |
| 139, | |
| "strings-extra@2.2.1": | |
| 139, | |
| "strings-extra@3.0.0": | |
| 101, | |
| "strings-extra@3.0.1": | |
| 97, | |
| "strings-extra@4.0.0": | |
| 92, | |
| "stringutils@0.0.1": | |
| 108, | |
| "stringutils@0.0.2": | |
| 92, | |
| "stringutils@0.0.3": | |
| 51, | |
| "stringutils@0.0.4": | |
| 93, | |
| "stringutils@0.0.5": | |
| 140, | |
| "stringutils@0.0.6": | |
| 143, | |
| "stringutils@0.0.7": | |
| 144, | |
| "stringutils@0.0.8": | |
| 130, | |
| "stringutils@0.0.9": | |
| 131, | |
| "stringutils@0.0.10": | |
| 188, | |
| "stringutils@0.0.11": | |
| 82, | |
| "stringutils@0.0.12": | |
| 82, | |
| "strongcheck@0.3.2": | |
| -79, | |
| "strongcheck@0.3.3": | |
| -83, | |
| "strongcheck@0.3.4": | |
| -161, | |
| "strongcheck@0.4.0": | |
| -79, | |
| "strongcheck@0.4.1": | |
| -60, | |
| "strongcheck@0.4.2": | |
| -82, | |
| "strongcheck@0.4.3": | |
| -81, | |
| "strongcheck@0.4.4": | |
| -79, | |
| "strongcheck@0.4.5": | |
| -86, | |
| "strongcheck@0.4.6": | |
| -81, | |
| "strongcheck@0.4.7": | |
| -167, | |
| "strongcheck@0.4.8": | |
| -92, | |
| "strongcheck@0.4.9": | |
| -63, | |
| "strongcheck@0.4.10": | |
| -74, | |
| "strongcheck@0.4.11": | |
| -90, | |
| "strongcheck@0.4.12": | |
| -90, | |
| "strongcheck@0.4.13": | |
| -92, | |
| "strongcheck@0.4.14": | |
| -92, | |
| "strongcheck@0.4.15": | |
| -192, | |
| "strongcheck@0.4.16": | |
| -103, | |
| "strongcheck@0.5.0": | |
| -78, | |
| "strongcheck@0.5.1": | |
| -100, | |
| "strongcheck@0.5.2": | |
| -93, | |
| "strongcheck@0.6.0": | |
| -86, | |
| "strongcheck@0.7.0": | |
| -80, | |
| "strongcheck@0.8.0": | |
| 92, | |
| "strongcheck@0.9.0": | |
| 193, | |
| "strongcheck@0.10.0": | |
| 90, | |
| "strongcheck@0.11.0": | |
| 73, | |
| "strongcheck@0.12.0": | |
| 81, | |
| "strongcheck@0.12.1": | |
| 91, | |
| "strongcheck@0.13.0": | |
| 91, | |
| "strongcheck@0.14.0": | |
| 98, | |
| "strongcheck@0.14.1": | |
| 96, | |
| "strongcheck@0.14.2": | |
| 191, | |
| "strongcheck@0.14.3": | |
| 81, | |
| "strongcheck@0.14.4": | |
| 78, | |
| "strongcheck@0.14.5": | |
| 82, | |
| "strongcheck@0.14.6": | |
| 94, | |
| "strongcheck@0.14.7": | |
| 93, | |
| "strongcheck@1.0.0": | |
| 83, | |
| "strongcheck@1.1.0": | |
| 80, | |
| "strongcheck@1.1.1": | |
| 176, | |
| "strongcheck@2.0.0": | |
| 311, | |
| "strongcheck@2.0.1": | |
| -226, | |
| "strongcheck@2.0.2": | |
| 276, | |
| "strongcheck@2.1.0": | |
| 283, | |
| "strongcheck@3.0.0": | |
| 290, | |
| "strongcheck@3.1.0": | |
| 273, | |
| "strongcheck@4.0.0": | |
| 168, | |
| "strongcheck@4.1.0": | |
| 274, | |
| "strongcheck@4.1.1": | |
| 161, | |
| "strongcheck@5.0.0": | |
| 148, | |
| "strongcheck@5.0.1": | |
| 170, | |
| "strongcheck-argonaut@1.0.0": | |
| 543, | |
| "strongcheck-argonaut@1.1.0": | |
| 509, | |
| "strongcheck-generics@0.1.0": | |
| 207, | |
| "strongcheck-generics@0.2.0": | |
| 95, | |
| "strongcheck-generics@0.2.1": | |
| 94, | |
| "strongcheck-generics@0.3.0": | |
| 105, | |
| "strongcheck-generics@0.4.0": | |
| 87, | |
| "strongcheck-generics@0.5.0": | |
| -239, | |
| "strongcheck-generics@0.5.1": | |
| -236, | |
| "strongcheck-generics@1.0.0": | |
| 285, | |
| "strongcheck-laws@1.0.0": | |
| 495, | |
| "strongcheck-laws@2.0.0": | |
| 506, | |
| "strongcheck-laws@3.0.0": | |
| 178, | |
| "strongcheck-laws@3.1.0": | |
| 186, | |
| "strongcheck-laws@3.2.0": | |
| 184, | |
| "strongcheck-laws@3.2.1": | |
| 186, | |
| "struct@0.1.0": | |
| 242, | |
| "struct@1.0.0": | |
| 163, | |
| "struct@1.0.1": | |
| 153, | |
| "struct@1.1.0": | |
| 461, | |
| "style@0.0.1": | |
| 182, | |
| "style@0.1.0": | |
| 154, | |
| "style@0.2.0": | |
| 156, | |
| "style@0.3.0": | |
| 289, | |
| "style@0.4.0": | |
| 143, | |
| "style@0.5.0": | |
| 113, | |
| "style@0.6.0": | |
| 128, | |
| "style@0.7.0": | |
| 129, | |
| "style@0.8.0": | |
| 131, | |
| "style@0.9.0": | |
| 133, | |
| "style@0.10.0": | |
| 213, | |
| "style@0.11.0": | |
| 118, | |
| "style@0.12.0": | |
| 115, | |
| "style@0.13.0": | |
| 122, | |
| "style@0.14.0": | |
| 130, | |
| "style@0.14.1": | |
| 133, | |
| "style@0.15.0": | |
| 131, | |
| "style@0.16.0": | |
| 130, | |
| "style@0.17.0": | |
| 217, | |
| "stylesheet@0.0.1": | |
| 40, | |
| "stylesheet@0.0.2": | |
| 315, | |
| "stylesheet@0.0.3": | |
| 158, | |
| "subcategory@0.1.0": | |
| 96, | |
| "subcategory@0.1.1": | |
| 87, | |
| "subcategory@0.2.0": | |
| 88, | |
| "subrecord@0.1.0": | |
| 73, | |
| "subscriber@1.0.0": | |
| 220, | |
| "subscriber@1.1.0": | |
| 118, | |
| "subscriber@1.1.1": | |
| 116, | |
| "subscriber@1.1.2": | |
| 276, | |
| "subscriber@2.0.0": | |
| -612, | |
| "substitute@0.1.0": | |
| 178, | |
| "substitute@0.1.1": | |
| 250, | |
| "substitute@0.2.0": | |
| -116, | |
| "substitute@0.2.1": | |
| -214, | |
| "substitute@0.2.2": | |
| -80, | |
| "substitute@0.2.3": | |
| -79, | |
| "substructural@0.0.1": | |
| 132, | |
| "substructural@0.0.2": | |
| 126, | |
| "substructural@0.0.3": | |
| 123, | |
| "substructural@0.0.4": | |
| 124, | |
| "substructural@0.0.5": | |
| 228, | |
| "substructural@0.0.6": | |
| 115, | |
| "substructural@0.0.7": | |
| 61, | |
| "substructural@0.0.8": | |
| 82, | |
| "substructural@0.0.9": | |
| 81, | |
| "substructural@0.0.10": | |
| 82, | |
| "substructural@0.0.11": | |
| 80, | |
| "substructural@0.0.12": | |
| 176, | |
| "substructural@0.0.13": | |
| 78, | |
| "substructural@0.0.14": | |
| 64, | |
| "substructural@0.0.15": | |
| 78, | |
| "substructural@0.0.16": | |
| 83, | |
| "substructural@0.0.17": | |
| 81, | |
| "substructural@0.0.18": | |
| 165, | |
| "substructural@0.0.19": | |
| 96, | |
| "subtlecrypto@0.0.0": | |
| 299, | |
| "subtlecrypto@0.0.1": | |
| 301, | |
| "sudoku@0.1.0": | |
| 90, | |
| "sudoku@1.0.0": | |
| 117, | |
| "suggest@1.0.0": | |
| 87, | |
| "suggest@1.0.1": | |
| -201, | |
| "suggest@2.0.0": | |
| -542, | |
| "suggest@2.1.1": | |
| -399, | |
| "suggest@2.2.0": | |
| -394, | |
| "suggest@2.3.0": | |
| 461, | |
| "suggest@3.0.0": | |
| 453, | |
| "suggest@4.0.0": | |
| 314, | |
| "suggest@5.0.0": | |
| 323, | |
| "sunde@0.1.0": | |
| 551, | |
| "sunde@1.0.0": | |
| 430, | |
| "sunde@2.0.0": | |
| 423, | |
| "sunde@3.0.0": | |
| 138, | |
| "super-spec@0.4.0": | |
| 75, | |
| "super-spec@0.5.0": | |
| 79, | |
| "super-spec@0.5.1": | |
| 193, | |
| "super-spec@0.5.2": | |
| 74, | |
| "super-spec@0.6.0": | |
| 89, | |
| "super-spec@0.6.1": | |
| 92, | |
| "super-spec@0.6.2": | |
| 97, | |
| "super-spec@0.7.0": | |
| 96, | |
| "super-spec@0.7.1": | |
| 94, | |
| "super-spec@0.7.2": | |
| 96, | |
| "super-spec@0.7.3": | |
| 183, | |
| "super-spec@0.8.0": | |
| 73, | |
| "super-spec@0.8.1": | |
| 74, | |
| "super-spec@0.8.2": | |
| 95, | |
| "super-spec@0.8.3": | |
| 94, | |
| "super-spec@0.8.4": | |
| 88, | |
| "super-spec@0.9.0": | |
| 78, | |
| "super-spec@0.9.1": | |
| 151, | |
| "super-spec@0.9.2": | |
| 67, | |
| "super-spec@0.9.3": | |
| 69, | |
| "supply@0.1.0": | |
| 72, | |
| "supply@0.2.0": | |
| 79, | |
| "svg-parser@1.0.0": | |
| 295, | |
| "svg-parser@2.0.0": | |
| 92, | |
| "svg-parser@3.0.0": | |
| 77, | |
| "svg-parser-halogen@0.1.0": | |
| 799, | |
| "svg-parser-halogen@0.2.0": | |
| 788, | |
| "svg-parser-halogen@0.3.0": | |
| 388, | |
| "svg-parser-halogen@0.4.0": | |
| 395, | |
| "svg-parser-halogen@1.0.0": | |
| 712, | |
| "svg-parser-halogen@2.0.0": | |
| 232, | |
| "svg-parser-smolder@1.0.0": | |
| 316, | |
| "svgo@0.1.0": | |
| 358, | |
| "symbiote@0.0.0": | |
| 645, | |
| "symbols@1.0.0": | |
| 61, | |
| "symbols@1.0.1": | |
| 66, | |
| "symbols@2.0.0": | |
| 148, | |
| "symbols@3.0.0": | |
| 49, | |
| "symbols@3.0.1": | |
| 52, | |
| "symmetric-groups@0.1.0": | |
| 257, | |
| "symmetric-groups@0.1.1": | |
| 213, | |
| "symmetric-groups@0.1.2": | |
| 209, | |
| "systemd-journald@0.1.1": | |
| 61, | |
| "systemd-journald@0.1.3": | |
| 137, | |
| "systemd-journald@0.2.0": | |
| 51, | |
| "systemd-journald@0.2.1": | |
| 51, | |
| "systemd-journald@0.3.0": | |
| 62, | |
| "tables@0.0.1": | |
| 158, | |
| "tables@0.0.2": | |
| 122, | |
| "tables@0.0.5": | |
| 121, | |
| "tables@0.0.7": | |
| 267, | |
| "tables-parse@0.0.1": | |
| 191, | |
| "tables-parse@0.0.2": | |
| 183, | |
| "tables-parse@0.1.0": | |
| 196, | |
| "tables-parse@0.1.1": | |
| 213, | |
| "tables-parse@0.1.2": | |
| 215, | |
| "tagged@1.0.0": | |
| 73, | |
| "tagged@2.0.0": | |
| 103, | |
| "tagged@3.0.0": | |
| 81, | |
| "tagged@4.0.0": | |
| 51, | |
| "tagged@4.0.1": | |
| 61, | |
| "tagged@4.0.2": | |
| 74, | |
| "tagged-sum@1.0.0": | |
| 300, | |
| "tagged-sum@1.1.0": | |
| 200, | |
| "tailrec@0.1.0": | |
| 50, | |
| "tailrec@0.1.1": | |
| 76, | |
| "tailrec@0.1.2": | |
| 74, | |
| "tailrec@0.2.0": | |
| 76, | |
| "tailrec@0.2.1": | |
| 76, | |
| "tailrec@0.2.2": | |
| 79, | |
| "tailrec@0.3.0": | |
| 119, | |
| "tailrec@0.3.1": | |
| 91, | |
| "tailrec@1.0.0": | |
| 45, | |
| "tailrec@2.0.0": | |
| 74, | |
| "tailrec@2.0.1": | |
| 71, | |
| "tailrec@2.0.2": | |
| 75, | |
| "tailrec@3.0.0": | |
| 71, | |
| "tailrec@3.1.0": | |
| 81, | |
| "tailrec@3.2.0": | |
| 165, | |
| "tailrec@3.3.0": | |
| 93, | |
| "tailrec@4.0.0": | |
| 49, | |
| "tailrec@4.1.0": | |
| 66, | |
| "tailrec@4.1.1": | |
| 72, | |
| "tailrec@5.0.0": | |
| 66, | |
| "tailrec@5.0.1": | |
| 71, | |
| "tailrec@6.0.0": | |
| 67, | |
| "tailrec@6.1.0": | |
| 73, | |
| "task@0.1.0": | |
| 206, | |
| "task@0.2.0": | |
| 145, | |
| "task@0.2.1": | |
| 146, | |
| "task@0.3.0": | |
| 183, | |
| "task@0.3.1": | |
| -115, | |
| "task@0.3.2": | |
| -199, | |
| "taylor@1.0.0": | |
| 51, | |
| "taylor@1.0.1": | |
| 59, | |
| "taylor@2.0.0": | |
| 158, | |
| "taylor@3.0.0": | |
| 182, | |
| "taylor@4.0.0": | |
| 84, | |
| "tecton@0.1.0": | |
| 177, | |
| "tecton@0.1.1": | |
| 95, | |
| "tecton@0.1.2": | |
| 83, | |
| "tecton@0.1.3": | |
| 85, | |
| "tecton@0.1.4": | |
| 98, | |
| "tecton-halogen@0.1.0": | |
| 224, | |
| "tecton-halogen@0.1.1": | |
| 215, | |
| "tecton-halogen@0.1.2": | |
| 210, | |
| "telegraf@0.1.0": | |
| 143, | |
| "telegraf@0.2.1": | |
| 166, | |
| "telegraf@0.2.2": | |
| 121, | |
| "telegraf@0.3.0": | |
| 124, | |
| "telegraf@0.3.1": | |
| 142, | |
| "telegraf@0.4.0": | |
| 138, | |
| "telegraf@0.4.1": | |
| 136, | |
| "telegraf@0.5.0": | |
| 491, | |
| "teller@1.0.0": | |
| 446, | |
| "teller@2.0.0": | |
| 315, | |
| "teller@3.0.0": | |
| 312, | |
| "teller@4.0.0": | |
| 327, | |
| "teller@5.0.0": | |
| 326, | |
| "teller@6.0.0": | |
| 331, | |
| "teller@7.0.0": | |
| 440, | |
| "teller@8.0.0": | |
| 325, | |
| "teller@9.0.0": | |
| 310, | |
| "teller@10.0.0": | |
| 323, | |
| "teller@10.0.1": | |
| 329, | |
| "teller@10.0.2": | |
| 331, | |
| "teller@10.0.3": | |
| 335, | |
| "teller@10.0.4": | |
| 335, | |
| "teller@10.1.0": | |
| 412, | |
| "teller@10.1.1": | |
| 320, | |
| "teller@10.1.2": | |
| 319, | |
| "teller@10.1.3": | |
| 330, | |
| "teller@10.1.4": | |
| 330, | |
| "teller@10.1.5": | |
| 429, | |
| "teller@10.1.6": | |
| 317, | |
| "teller@10.1.7": | |
| 314, | |
| "teller@10.1.8": | |
| 329, | |
| "teller@10.1.9": | |
| 329, | |
| "teller@10.1.10": | |
| 426, | |
| "teller@10.1.11": | |
| 321, | |
| "teller@10.1.12": | |
| 318, | |
| "teller@10.2.0": | |
| 322, | |
| "teller@10.3.0": | |
| 388, | |
| "teller@10.3.1": | |
| 351, | |
| "teller@10.3.2": | |
| 341, | |
| "template-dust@1.0.0": | |
| 79, | |
| "template-dust@1.0.1": | |
| 137, | |
| "template-dust@1.0.2": | |
| 47, | |
| "template-dust@1.0.3": | |
| 63, | |
| "template-dust@1.0.4": | |
| 66, | |
| "template-dust@2.0.0": | |
| 92, | |
| "template-dust@2.0.1": | |
| 81, | |
| "template-dust@3.0.0": | |
| 142, | |
| "template-dust@3.0.1": | |
| 81, | |
| "template-literals@0.1.0": | |
| 269, | |
| "template-literals@0.2.0": | |
| 272, | |
| "template-strings@1.0.0": | |
| 59, | |
| "template-strings@1.1.0": | |
| 74, | |
| "template-strings@1.1.1": | |
| 68, | |
| "template-strings@2.0.0": | |
| 122, | |
| "template-strings@3.0.0": | |
| 66, | |
| "template-strings@4.0.0": | |
| 95, | |
| "template-strings@5.0.0": | |
| 75, | |
| "template-strings@5.1.0": | |
| 69, | |
| "test-unit@1.0.0": | |
| 153, | |
| "test-unit@1.1.0": | |
| 66, | |
| "test-unit@1.1.1": | |
| 59, | |
| "test-unit@1.1.2": | |
| 69, | |
| "test-unit@1.1.3": | |
| 79, | |
| "test-unit@1.1.4": | |
| 73, | |
| "test-unit@1.1.5": | |
| 76, | |
| "test-unit@1.1.6": | |
| 78, | |
| "test-unit@2.0.0": | |
| 167, | |
| "test-unit@3.0.0": | |
| 87, | |
| "test-unit@4.0.0": | |
| 61, | |
| "test-unit@4.1.0": | |
| 77, | |
| "test-unit@5.0.0": | |
| 87, | |
| "test-unit@6.0.0": | |
| 84, | |
| "test-unit@6.0.1": | |
| 87, | |
| "test-unit@7.0.0": | |
| 79, | |
| "test-unit@7.0.1": | |
| 179, | |
| "test-unit@8.0.0": | |
| 92, | |
| "test-unit@9.0.0": | |
| 65, | |
| "test-unit@9.1.0": | |
| 69, | |
| "test-unit@10.0.0": | |
| 305, | |
| "test-unit@10.0.1": | |
| 321, | |
| "test-unit@10.0.2": | |
| -255, | |
| "test-unit@10.1.0": | |
| -244, | |
| "test-unit@11.0.0": | |
| 781, | |
| "test-unit@12.0.0": | |
| 517, | |
| "test-unit@13.0.0": | |
| 480, | |
| "test-unit@14.0.0": | |
| 273, | |
| "test-unit@15.0.0": | |
| 288, | |
| "test-unit@16.0.0": | |
| 142, | |
| "test-unit@17.0.0": | |
| 114, | |
| "text@0.0.1": | |
| 241, | |
| "text-encoding@0.0.7": | |
| 91, | |
| "text-encoding@0.0.8": | |
| 90, | |
| "text-encoding@0.0.9": | |
| 112, | |
| "text-encoding@1.0.0": | |
| 123, | |
| "textcursor@0.1.0": | |
| 875, | |
| "textcursor@0.1.1": | |
| 963, | |
| "textcursor@1.0.0": | |
| 223, | |
| "textcursor@2.0.0": | |
| 250, | |
| "thermite@0.1.0": | |
| 53, | |
| "thermite@0.2.0": | |
| 74, | |
| "thermite@0.3.0": | |
| 67, | |
| "thermite@0.4.0": | |
| 66, | |
| "thermite@0.4.1": | |
| 68, | |
| "thermite@0.4.2": | |
| 158, | |
| "thermite@0.5.0": | |
| 59, | |
| "thermite@0.5.1": | |
| 54, | |
| "thermite@0.5.2": | |
| 58, | |
| "thermite@0.5.3": | |
| 73, | |
| "thermite@0.5.4": | |
| 67, | |
| "thermite@0.6.0": | |
| 72, | |
| "thermite@0.6.1": | |
| 81, | |
| "thermite@0.7.0": | |
| 127, | |
| "thermite@0.7.1": | |
| 49, | |
| "thermite@0.7.2": | |
| 63, | |
| "thermite@0.7.3": | |
| 60, | |
| "thermite@0.7.4": | |
| 76, | |
| "thermite@0.8.0": | |
| 68, | |
| "thermite@0.9.0": | |
| 236, | |
| "thermite@0.10.0": | |
| 108, | |
| "thermite@0.10.1": | |
| 106, | |
| "thermite@0.11.0": | |
| 169, | |
| "thermite@0.12.0": | |
| 173, | |
| "thermite@0.12.1": | |
| 165, | |
| "thermite@0.13.0": | |
| 168, | |
| "thermite@0.13.1": | |
| 169, | |
| "thermite@0.14.0": | |
| 270, | |
| "thermite@0.15.0": | |
| -127, | |
| "thermite@0.15.1": | |
| -116, | |
| "thermite@1.0.0": | |
| 92, | |
| "thermite@1.0.1": | |
| 93, | |
| "thermite@2.0.0": | |
| 96, | |
| "thermite@3.0.0": | |
| 662, | |
| "thermite@3.1.0": | |
| 572, | |
| "thermite@3.2.0": | |
| 556, | |
| "thermite@3.2.1": | |
| -519, | |
| "thermite@4.0.0": | |
| 721, | |
| "thermite@4.1.0": | |
| 631, | |
| "thermite@4.1.1": | |
| 636, | |
| "thermite@5.0.0": | |
| 825, | |
| "thermite@6.0.0": | |
| 298, | |
| "thermite@6.0.1": | |
| 296, | |
| "thermite@6.0.2": | |
| 311, | |
| "thermite@6.1.0": | |
| 234, | |
| "thermite@6.2.0": | |
| 229, | |
| "thermite@6.3.0": | |
| 347, | |
| "thermite@6.3.1": | |
| 257, | |
| "thermite-dom@0.0.0": | |
| 520, | |
| "thermite-dom@0.0.1": | |
| 532, | |
| "thermite-dom@0.1.0": | |
| 477, | |
| "thermite-dom@0.2.0": | |
| 477, | |
| "thermite-dom@0.3.0": | |
| 492, | |
| "thermite-dom@0.3.1": | |
| 371, | |
| "these@0.1.0": | |
| 61, | |
| "these@0.2.0": | |
| 86, | |
| "these@0.2.1": | |
| 71, | |
| "these@0.3.0": | |
| 69, | |
| "these@0.3.1": | |
| 125, | |
| "these@0.3.2": | |
| 105, | |
| "these@0.3.3": | |
| 46, | |
| "these@0.3.4": | |
| 64, | |
| "these@1.0.0": | |
| 72, | |
| "these@2.0.0": | |
| 126, | |
| "these@3.0.0": | |
| 146, | |
| "these@3.1.0": | |
| 108, | |
| "these@4.0.0": | |
| 95, | |
| "these@5.0.0": | |
| 210, | |
| "these@6.0.0": | |
| 96, | |
| "timers@0.0.3": | |
| 44, | |
| "timers@0.0.4": | |
| 72, | |
| "timers@0.0.5": | |
| 65, | |
| "timers@0.0.6": | |
| 72, | |
| "timers@0.0.7": | |
| 126, | |
| "timers@0.0.8": | |
| 45, | |
| "timers@0.0.9": | |
| 57, | |
| "timers@1.0.0": | |
| 92, | |
| "timeseries@0.3.0": | |
| -305, | |
| "timeseries@0.4.0": | |
| 263, | |
| "timeseries@0.5.0": | |
| 254, | |
| "timeseries@0.6.0": | |
| 261, | |
| "timeseries@0.6.1": | |
| 378, | |
| "timeseries@0.7.0": | |
| 260, | |
| "timeseries@0.8.0": | |
| 257, | |
| "timeseries@0.8.1": | |
| 273, | |
| "tolerant-argonaut@0.1.0": | |
| 507, | |
| "tolerant-argonaut@1.0.0": | |
| 510, | |
| "tolerant-argonaut@1.0.1": | |
| 627, | |
| "tolerant-argonaut@1.1.0": | |
| 447, | |
| "tolerant-argonaut@2.0.0": | |
| 432, | |
| "toppokki@1.0.0": | |
| 429, | |
| "toppokki@1.1.0": | |
| 418, | |
| "toppokki@2.0.0": | |
| 409, | |
| "toppokki@2.1.0": | |
| 457, | |
| "toppokki@2.2.0": | |
| 523, | |
| "toppokki@2.3.0": | |
| 401, | |
| "toppokki@2.4.0": | |
| 392, | |
| "toppokki@2.5.0": | |
| 16378, | |
| "toppokki@3.0.0": | |
| 187, | |
| "toppokki@4.0.0": | |
| 255, | |
| "tortellini@0.1.0": | |
| 147, | |
| "tortellini@1.0.0": | |
| 129, | |
| "tortellini@2.0.0": | |
| 163, | |
| "tortellini@2.0.1": | |
| 171, | |
| "tortellini@3.0.0": | |
| 171, | |
| "tortellini@4.0.0": | |
| 165, | |
| "tortellini@5.0.0": | |
| 175, | |
| "tortellini@5.1.0": | |
| 296, | |
| "totally@0.1.0": | |
| 46, | |
| "totally@0.2.0": | |
| 58, | |
| "totally@0.3.0": | |
| 68, | |
| "totally@1.0.0": | |
| 80, | |
| "transformerless@1.1.1": | |
| 75, | |
| "transformerless@2.0.0": | |
| 104, | |
| "transformerless@2.1.0": | |
| 102, | |
| "transformerless@2.2.0": | |
| 204, | |
| "transformerless@2.2.1": | |
| 80, | |
| "transformerless@2.3.0": | |
| 81, | |
| "transformerless@3.0.0": | |
| 85, | |
| "transformerless@3.0.1": | |
| 99, | |
| "transformerless@3.0.2": | |
| 95, | |
| "transformerless@4.0.0": | |
| 77, | |
| "transformerless@4.0.1": | |
| 160, | |
| "transformerless@4.0.2": | |
| 95, | |
| "transformerless@4.1.0": | |
| 60, | |
| "transformers@0.3.0": | |
| -64, | |
| "transformers@0.3.1": | |
| 72, | |
| "transformers@0.3.2": | |
| 74, | |
| "transformers@0.4.0": | |
| 73, | |
| "transformers@0.4.1": | |
| 70, | |
| "transformers@0.5.0": | |
| 110, | |
| "transformers@0.5.1": | |
| 131, | |
| "transformers@0.5.2": | |
| 50, | |
| "transformers@0.5.3": | |
| 57, | |
| "transformers@0.5.4": | |
| 77, | |
| "transformers@0.5.5": | |
| 74, | |
| "transformers@0.6.0": | |
| 79, | |
| "transformers@0.6.1": | |
| 75, | |
| "transformers@0.7.1": | |
| 80, | |
| "transformers@0.7.2": | |
| 185, | |
| "transformers@0.8.0": | |
| 91, | |
| "transformers@0.8.1": | |
| 55, | |
| "transformers@0.8.2": | |
| 78, | |
| "transformers@0.8.3": | |
| 76, | |
| "transformers@0.8.4": | |
| 77, | |
| "transformers@1.0.0": | |
| 68, | |
| "transformers@2.0.0": | |
| 193, | |
| "transformers@2.0.1": | |
| 108, | |
| "transformers@2.0.2": | |
| 75, | |
| "transformers@2.1.0": | |
| 78, | |
| "transformers@2.2.0": | |
| 88, | |
| "transformers@2.3.0": | |
| 91, | |
| "transformers@3.0.0": | |
| 111, | |
| "transformers@3.1.0": | |
| 107, | |
| "transformers@3.2.0": | |
| 198, | |
| "transformers@3.3.0": | |
| 96, | |
| "transformers@3.4.0": | |
| 85, | |
| "transformers@3.5.0": | |
| 91, | |
| "transformers@3.6.0": | |
| 103, | |
| "transformers@4.0.0": | |
| 80, | |
| "transformers@4.1.0": | |
| 82, | |
| "transformers@4.2.0": | |
| 81, | |
| "transformers@5.0.0": | |
| 172, | |
| "transformers@5.1.0": | |
| 82, | |
| "transformers@5.2.0": | |
| 64, | |
| "transformers@6.0.0": | |
| 58, | |
| "tree@1.0.0": | |
| 107, | |
| "tree@1.1.0": | |
| 104, | |
| "tree@1.2.0": | |
| 99, | |
| "tree@1.3.0": | |
| 253, | |
| "tree@1.3.1": | |
| 355, | |
| "tree@1.3.2": | |
| 242, | |
| "tree-rose@2.0.0": | |
| 87, | |
| "tree-rose@2.0.1": | |
| 91, | |
| "tree-rose@3.0.0": | |
| 100, | |
| "tree-rose@4.0.0": | |
| 86, | |
| "tree-rose@4.0.2": | |
| 91, | |
| "tree-sitter@0.1.2": | |
| 62, | |
| "tree-sitter@0.1.3": | |
| 91, | |
| "treemap@0.1.0": | |
| 120, | |
| "treemap@0.1.1": | |
| 52, | |
| "trie@0.0.1": | |
| 247, | |
| "trie@0.0.2": | |
| 254, | |
| "tritium@1.0.0": | |
| 493, | |
| "tritium@1.0.1": | |
| 496, | |
| "tritium@1.0.2": | |
| 500, | |
| "tritium@1.1.0": | |
| 615, | |
| "tropical@1.0.1": | |
| 41, | |
| "tropical@2.0.0": | |
| 58, | |
| "tropical@3.0.0": | |
| 53, | |
| "tropical@4.0.0": | |
| 81, | |
| "trout@0.4.0": | |
| -704, | |
| "trout@0.4.1": | |
| -710, | |
| "trout@0.5.0": | |
| -496, | |
| "trout@0.6.0": | |
| -398, | |
| "trout@0.7.0": | |
| 614, | |
| "trout@0.8.0": | |
| 616, | |
| "trout@0.8.1": | |
| 617, | |
| "trout@0.9.0": | |
| 621, | |
| "trout@0.9.1": | |
| 621, | |
| "trout@0.10.0": | |
| 779, | |
| "trout@0.11.0": | |
| 525, | |
| "trout@0.12.0": | |
| -557, | |
| "trout@0.12.1": | |
| 487, | |
| "trout@0.12.2": | |
| 492, | |
| "trout@0.12.3": | |
| 463, | |
| "trout-client@0.7.0": | |
| 1415, | |
| "trout-client@0.8.0": | |
| 1265, | |
| "trout-client@0.10.0": | |
| 1285, | |
| "trout-client@0.11.0": | |
| -731, | |
| "trout-client@0.12.0": | |
| 884, | |
| "trout-client@0.12.1": | |
| 666, | |
| "trout-client@0.13.0": | |
| 646, | |
| "tscompat@1.0.0": | |
| 62, | |
| "tscompat@1.0.1": | |
| 82, | |
| "tupc@0.1.0": | |
| 629, | |
| "tupc@0.1.1": | |
| 583, | |
| "tuples@0.2.3": | |
| 65, | |
| "tuples@0.3.0": | |
| 134, | |
| "tuples@0.3.1": | |
| 49, | |
| "tuples@0.3.2": | |
| 67, | |
| "tuples@0.3.3": | |
| 66, | |
| "tuples@0.3.4": | |
| 71, | |
| "tuples@0.4.0": | |
| 75, | |
| "tuples@1.0.0": | |
| 140, | |
| "tuples@2.0.0": | |
| 72, | |
| "tuples@3.0.0": | |
| 62, | |
| "tuples@3.1.0": | |
| 73, | |
| "tuples@3.2.0": | |
| 70, | |
| "tuples@4.0.0": | |
| 72, | |
| "tuples@4.1.0": | |
| 82, | |
| "tuples@5.0.0": | |
| 69, | |
| "tuples@5.1.0": | |
| 127, | |
| "tuples@6.0.0": | |
| 50, | |
| "tuples@6.0.1": | |
| 51, | |
| "tuples@7.0.0": | |
| 68, | |
| "tuples-native@0.0.0": | |
| 120, | |
| "tuples-native@0.0.1": | |
| 99, | |
| "tuples-native@0.1.0": | |
| 207, | |
| "tuples-native@1.0.0": | |
| 63, | |
| "tuples-native@1.0.1": | |
| 66, | |
| "tuples-native@2.0.0": | |
| 97, | |
| "tuples-native@2.0.1": | |
| 100, | |
| "tuples-native@2.0.2": | |
| 101, | |
| "tuples-native@2.1.0": | |
| 102, | |
| "turbine@0.0.1": | |
| 338, | |
| "turbine@0.0.2": | |
| 447, | |
| "turbine@0.0.3": | |
| 323, | |
| "turbine@0.0.4": | |
| 316, | |
| "turbine@0.0.5": | |
| 330, | |
| "turbine@0.1.0": | |
| 347, | |
| "turf@0.1.0": | |
| 348, | |
| "turf@0.1.1": | |
| 454, | |
| "turf@0.1.2": | |
| 326, | |
| "turf@1.0.0": | |
| 111, | |
| "turf@1.0.1": | |
| 128, | |
| "tweetnacl@0.4.0": | |
| 128, | |
| "tweetnacl@0.4.1": | |
| 128, | |
| "tweetnacl@0.5.0": | |
| 127, | |
| "tweetnacl@0.5.1": | |
| 634, | |
| "tweetnacl@0.5.2": | |
| 501, | |
| "tweetnacl@1.0.0": | |
| 207, | |
| "twilio@0.0.1": | |
| 161, | |
| "two-or-more@0.3.0": | |
| 87, | |
| "two-or-more@0.4.0": | |
| 200, | |
| "two-or-more@1.0.0": | |
| 75, | |
| "twoset@0.1.0": | |
| 43, | |
| "type-equality@1.0.0": | |
| 56, | |
| "type-equality@1.1.0": | |
| 73, | |
| "type-equality@2.0.0": | |
| 63, | |
| "type-equality@2.1.0": | |
| 82, | |
| "type-equality@3.0.0": | |
| 65, | |
| "type-equality@4.0.0": | |
| 133, | |
| "type-equality@4.0.1": | |
| 63, | |
| "type-isequal@0.1.0": | |
| 49, | |
| "typeable@0.0.1": | |
| 56, | |
| "typeable@0.0.2": | |
| 71, | |
| "typeable@0.0.3": | |
| -71, | |
| "typeable@1.0.0": | |
| 83, | |
| "typeable@2.0.0": | |
| 148, | |
| "typeable@3.0.0": | |
| 322, | |
| "typedarray@0.5.2": | |
| 43, | |
| "typedarray@1.0.0": | |
| 53, | |
| "typedarray@1.0.1": | |
| 64, | |
| "typedarray@1.1.0": | |
| 79, | |
| "typedarray@1.2.0": | |
| 70, | |
| "typedarray@1.2.1": | |
| 146, | |
| "typedarray@1.2.2": | |
| 54, | |
| "typedarray@1.2.3": | |
| 55, | |
| "typedarray@1.2.4": | |
| 71, | |
| "typedarray@2.0.0": | |
| 78, | |
| "typedarray@2.1.0": | |
| 70, | |
| "typedenv@0.0.1": | |
| 136, | |
| "typedenv@1.0.0": | |
| 246, | |
| "typelevel@1.0.0": | |
| 76, | |
| "typelevel@2.0.0": | |
| 58, | |
| "typelevel@3.0.0": | |
| 90, | |
| "typelevel@4.0.0": | |
| 72, | |
| "typelevel@5.0.0": | |
| 81, | |
| "typelevel@6.0.0": | |
| 68, | |
| "typelevel-arithmetic@0.1.0": | |
| 63, | |
| "typelevel-codec-json@1.0.0": | |
| 217, | |
| "typelevel-eval@0.1.0": | |
| 48, | |
| "typelevel-eval@0.2.0": | |
| 64, | |
| "typelevel-eval@0.3.0": | |
| 74, | |
| "typelevel-eval@0.4.0": | |
| 64, | |
| "typelevel-eval@0.5.0": | |
| -159, | |
| "typelevel-lists@0.1.0": | |
| 48, | |
| "typelevel-lists@0.2.0": | |
| 56, | |
| "typelevel-lists@0.3.0": | |
| 128, | |
| "typelevel-lists@0.3.1": | |
| 105, | |
| "typelevel-lists@1.0.0": | |
| 104, | |
| "typelevel-lists@1.1.0": | |
| 96, | |
| "typelevel-lists@2.0.0": | |
| 225, | |
| "typelevel-lists@2.0.1": | |
| 84, | |
| "typelevel-lists@2.1.0": | |
| 77, | |
| "typelevel-peano@0.1.8": | |
| 74, | |
| "typelevel-peano@1.0.1": | |
| 96, | |
| "typelevel-prelude@1.0.0": | |
| 61, | |
| "typelevel-prelude@2.0.0": | |
| 80, | |
| "typelevel-prelude@2.1.0": | |
| 76, | |
| "typelevel-prelude@2.2.0": | |
| 148, | |
| "typelevel-prelude@2.3.0": | |
| 79, | |
| "typelevel-prelude@2.3.1": | |
| 63, | |
| "typelevel-prelude@2.4.0": | |
| 72, | |
| "typelevel-prelude@2.5.0": | |
| 76, | |
| "typelevel-prelude@2.6.0": | |
| 72, | |
| "typelevel-prelude@2.7.0": | |
| 83, | |
| "typelevel-prelude@3.0.0": | |
| 134, | |
| "typelevel-prelude@4.0.0": | |
| 48, | |
| "typelevel-prelude@4.0.1": | |
| 60, | |
| "typelevel-prelude@4.0.2": | |
| 57, | |
| "typelevel-prelude@5.0.0": | |
| 74, | |
| "typelevel-prelude@5.0.1": | |
| 67, | |
| "typelevel-prelude@5.0.2": | |
| 72, | |
| "typelevel-prelude@6.0.0": | |
| 140, | |
| "typelevel-prelude@7.0.0": | |
| 49, | |
| "typelevel-rowlist-limits@0.0.1": | |
| 126, | |
| "typelevel-rowlist-limits@0.0.2": | |
| 101, | |
| "typelevel-rowlist-limits@0.0.3": | |
| 100, | |
| "typelevel-rowlist-limits@0.0.6": | |
| 99, | |
| "typelevel-rows@0.1.0": | |
| 57, | |
| "typesafe-localstorage@0.0.1": | |
| 189, | |
| "typesafe-localstorage@0.0.2": | |
| 81, | |
| "ui@0.1.0": | |
| 49, | |
| "ui@0.1.1": | |
| 78, | |
| "ui@0.1.2": | |
| 75, | |
| "ui@0.2.0": | |
| 74, | |
| "ui@0.2.1": | |
| 75, | |
| "ui@0.3.0": | |
| 158, | |
| "uint@0.1.0": | |
| 47, | |
| "uint@0.2.0": | |
| 56, | |
| "uint@0.3.0": | |
| 72, | |
| "uint@0.4.0": | |
| 85, | |
| "uint@0.5.0": | |
| 89, | |
| "uint@4.0.0": | |
| 66, | |
| "uint@4.0.1": | |
| 122, | |
| "uint@4.0.2": | |
| 45, | |
| "uint@4.1.0": | |
| 426, | |
| "uint@5.0.0": | |
| 56, | |
| "uint@5.1.0": | |
| 110, | |
| "uint@5.1.1": | |
| 225, | |
| "uint@5.1.2": | |
| 138, | |
| "uint@5.1.3": | |
| 134, | |
| "uint@5.1.4": | |
| 139, | |
| "uint@6.0.0": | |
| 120, | |
| "uint@6.0.1": | |
| 123, | |
| "uint@6.0.2": | |
| 89, | |
| "uint@6.0.3": | |
| 178, | |
| "uint@7.0.0": | |
| 71, | |
| "uint-instances@0.0.0": | |
| 404, | |
| "uint-instances@0.0.1": | |
| 366, | |
| "uint-instances@0.0.2": | |
| 390, | |
| "uk-modulo@1.0.0": | |
| 76, | |
| "uk-modulo@1.0.1": | |
| 201, | |
| "uk-modulo@1.1.0": | |
| 191, | |
| "uk-modulo@1.2.0": | |
| 259, | |
| "uk-modulo@1.3.0": | |
| 147, | |
| "uk-modulo@1.4.0": | |
| 251, | |
| "uk-modulo@1.5.0": | |
| 254, | |
| "uk-modulo@1.6.0": | |
| 258, | |
| "uk-modulo@1.7.0": | |
| 158, | |
| "uk-modulo@1.8.0": | |
| 152, | |
| "uk-modulo@1.9.0": | |
| 261, | |
| "uk-modulo@5.0.0": | |
| 141, | |
| "uk-modulo@5.10.0": | |
| 137, | |
| "uk-modulo@5.20.0": | |
| 157, | |
| "uk-modulo@5.20.1": | |
| 152, | |
| "uk-modulo@5.30.0": | |
| 149, | |
| "uk-modulo@5.40.0": | |
| 258, | |
| "uk-modulo@5.50.0": | |
| 144, | |
| "uk-modulo@5.70.0": | |
| 140, | |
| "uk-modulo@5.80.0": | |
| 137, | |
| "uk-modulo@5.90.0": | |
| 148, | |
| "uk-modulo@5.90.1": | |
| 147, | |
| "uk-modulo@6.0.0": | |
| 153, | |
| "uk-modulo@6.12.0": | |
| 150, | |
| "ulid@1.0.0": | |
| 560, | |
| "ulid@2.0.0": | |
| 43, | |
| "ulid@3.0.0": | |
| 128, | |
| "ulid@3.0.1": | |
| 51, | |
| "unconsable@0.0.1": | |
| 143, | |
| "unconsable@0.0.2": | |
| 141, | |
| "uncurried-transformers@0.1.0": | |
| 77, | |
| "uncurried-transformers@1.0.0": | |
| 80, | |
| "uncurried-transformers@1.1.0": | |
| 172, | |
| "undefinable@0.1.0": | |
| 50, | |
| "undefinable@1.0.0": | |
| 56, | |
| "undefinable@2.0.0": | |
| 57, | |
| "undefinable@3.0.0": | |
| 75, | |
| "undefinable@4.0.0": | |
| 61, | |
| "undefined@1.0.1": | |
| 72, | |
| "undefined@1.0.2": | |
| 134, | |
| "undefined@2.0.0": | |
| 49, | |
| "undefined-is-not-a-problem@0.1.0": | |
| 210, | |
| "undefined-is-not-a-problem@0.1.1": | |
| 181, | |
| "undefined-is-not-a-problem@0.1.2": | |
| 178, | |
| "undefined-is-not-a-problem@0.2.0": | |
| 113, | |
| "undefined-is-not-a-problem@0.2.1": | |
| 107, | |
| "undefined-is-not-a-problem@1.0.0": | |
| 208, | |
| "undefined-is-not-a-problem@1.1.0": | |
| 83, | |
| "undefined-or@1.0.0": | |
| 46, | |
| "undefined-or@1.0.1": | |
| 59, | |
| "unfoldable@0.3.0": | |
| 70, | |
| "unfoldable@0.3.1": | |
| 73, | |
| "unfoldable@0.3.2": | |
| 72, | |
| "unfoldable@0.4.0": | |
| 73, | |
| "unfoldable@0.4.1": | |
| 154, | |
| "unfoldable@1.0.0": | |
| 53, | |
| "unfoldable@1.1.0": | |
| 51, | |
| "unfoldable@2.0.0": | |
| 83, | |
| "unfoldable@3.0.0": | |
| 90, | |
| "unfoldable@3.1.0": | |
| 95, | |
| "unfoldable@3.2.0": | |
| 100, | |
| "unfoldable@4.0.0": | |
| 156, | |
| "unfoldable@4.0.1": | |
| 82, | |
| "unfoldable@4.0.2": | |
| 73, | |
| "unfoldable@4.1.0": | |
| 60, | |
| "unfoldable@5.0.0": | |
| 85, | |
| "unfoldable@6.0.0": | |
| 71, | |
| "unicode@0.0.1": | |
| 67, | |
| "unicode@1.0.0": | |
| 70, | |
| "unicode@2.0.0": | |
| 153, | |
| "unicode@2.0.1": | |
| 74, | |
| "unicode@2.0.2": | |
| 77, | |
| "unicode@3.0.0": | |
| 207, | |
| "unicode@3.0.1": | |
| 335, | |
| "unicode@3.0.2": | |
| 201, | |
| "unicode@4.0.0": | |
| 218, | |
| "unicode@4.0.1": | |
| 122, | |
| "unicode@5.0.0": | |
| 77, | |
| "unicode@5.0.1": | |
| 90, | |
| "unicode@6.0.0": | |
| 98, | |
| "unicode-prelude@0.1.0": | |
| 65, | |
| "unicode-prelude@0.1.1": | |
| 82, | |
| "unicode-prelude@0.1.2": | |
| 73, | |
| "unicode-prelude@0.1.3": | |
| 87, | |
| "unicode-prelude@0.2.0": | |
| 112, | |
| "unicode-prelude@0.2.1": | |
| 46, | |
| "unicode-prelude@0.2.2": | |
| 53, | |
| "unicode-prelude@0.2.3": | |
| 69, | |
| "unicode-prelude@0.2.4": | |
| 69, | |
| "unique@0.0.1": | |
| 71, | |
| "unique@0.1.0": | |
| 64, | |
| "unique@0.2.0": | |
| 75, | |
| "unique@0.2.1": | |
| 128, | |
| "unique@0.2.2": | |
| 53, | |
| "unique@0.2.3": | |
| 52, | |
| "unique@0.3.0": | |
| 56, | |
| "unique@0.4.0": | |
| 68, | |
| "unique@0.5.0": | |
| 79, | |
| "unique-lists@0.0.1": | |
| 297, | |
| "unlift@1.0.0": | |
| 205, | |
| "unlift@1.0.1": | |
| -304, | |
| "unordered-collections@0.2.0": | |
| 39, | |
| "unordered-collections@1.0.0": | |
| 55, | |
| "unordered-collections@1.0.1": | |
| 73, | |
| "unordered-collections@1.1.0": | |
| 104, | |
| "unordered-collections@1.2.0": | |
| 100, | |
| "unordered-collections@1.3.0": | |
| 98, | |
| "unordered-collections@1.4.0": | |
| 196, | |
| "unordered-collections@1.5.0": | |
| 97, | |
| "unordered-collections@1.6.0": | |
| 81, | |
| "unordered-collections@1.7.0": | |
| 84, | |
| "unordered-collections@1.8.0": | |
| 97, | |
| "unordered-collections@1.8.1": | |
| 94, | |
| "unordered-collections@1.8.2": | |
| 93, | |
| "unordered-collections@1.8.3": | |
| 94, | |
| "unordered-collections@1.9.0": | |
| 176, | |
| "unordered-collections@1.9.1": | |
| 90, | |
| "unordered-collections@1.9.2": | |
| 88, | |
| "unordered-collections@1.10.0": | |
| 85, | |
| "unordered-collections@2.0.0": | |
| 103, | |
| "unordered-collections@2.1.0": | |
| 97, | |
| "unordered-collections@2.1.1": | |
| 96, | |
| "unordered-collections@2.1.2": | |
| 95, | |
| "unordered-collections@2.1.3": | |
| 193, | |
| "unordered-collections@2.1.4": | |
| 85, | |
| "unordered-collections@3.0.0": | |
| 81, | |
| "unordered-collections@3.0.1": | |
| 73, | |
| "unorm@0.0.0": | |
| 60, | |
| "unorm@1.0.0": | |
| 73, | |
| "unorm@1.0.1": | |
| 68, | |
| "unsafe-coerce@0.1.1": | |
| 68, | |
| "unsafe-coerce@1.0.0": | |
| 79, | |
| "unsafe-coerce@2.0.0": | |
| 140, | |
| "unsafe-coerce@3.0.0": | |
| 46, | |
| "unsafe-coerce@4.0.0": | |
| 54, | |
| "unsafe-coerce@5.0.0": | |
| 60, | |
| "unsafe-coerce@6.0.0": | |
| 73, | |
| "unsafe-reference@1.0.0": | |
| 64, | |
| "unsafe-reference@2.0.0": | |
| 105, | |
| "unsafe-reference@3.0.0": | |
| 73, | |
| "unsafe-reference@3.0.1": | |
| 81, | |
| "unsafe-reference@3.1.0": | |
| 151, | |
| "unsafe-reference@4.0.0": | |
| 46, | |
| "unsafe-reference@5.0.0": | |
| 52, | |
| "untagged-to-tagged@0.1.3": | |
| 151, | |
| "untagged-union@0.1.1": | |
| 154, | |
| "untagged-union@0.1.4": | |
| 108, | |
| "untagged-union@0.2.0": | |
| 149, | |
| "untagged-union@0.3.0": | |
| 113, | |
| "untagged-union@1.0.0": | |
| 211, | |
| "uri@0.2.0": | |
| 83, | |
| "uri@0.2.1": | |
| 76, | |
| "uri@0.2.2": | |
| 88, | |
| "uri@0.2.3": | |
| 89, | |
| "uri@0.2.4": | |
| 86, | |
| "uri@0.3.0": | |
| 87, | |
| "uri@0.3.1": | |
| 177, | |
| "uri@1.0.0": | |
| 72, | |
| "uri@2.0.0": | |
| 247, | |
| "uri@2.0.1": | |
| 185, | |
| "uri@3.0.0": | |
| 370, | |
| "uri@3.0.1": | |
| 338, | |
| "uri@3.1.0": | |
| 326, | |
| "uri@4.0.0": | |
| 326, | |
| "uri@4.0.1": | |
| 465, | |
| "uri@4.0.2": | |
| 307, | |
| "uri@4.1.0": | |
| 363, | |
| "uri@4.1.1": | |
| 372, | |
| "uri@4.2.0": | |
| 379, | |
| "uri@4.2.1": | |
| 357, | |
| "uri@4.2.2": | |
| 508, | |
| "uri@4.2.3": | |
| 371, | |
| "uri@4.2.4": | |
| 359, | |
| "uri@5.0.0": | |
| 305, | |
| "uri@5.1.0": | |
| 314, | |
| "uri@6.0.0": | |
| 273, | |
| "uri@6.1.0": | |
| 271, | |
| "uri@7.0.0": | |
| 282, | |
| "uri@8.0.0": | |
| 246, | |
| "uri@8.0.1": | |
| 136, | |
| "uri@9.0.0": | |
| 98, | |
| "uri-extra@0.0.0": | |
| 531, | |
| "uri-extra@0.0.1": | |
| 519, | |
| "uri-extra@0.0.2": | |
| 603, | |
| "uri-extra@0.0.3": | |
| 710, | |
| "url-regex-safe@0.1.0": | |
| 76, | |
| "url-validator@1.0.0": | |
| 45, | |
| "url-validator@1.0.1": | |
| 75, | |
| "url-validator@1.0.2": | |
| 67, | |
| "url-validator@1.1.0": | |
| 67, | |
| "url-validator@1.2.0": | |
| 85, | |
| "url-validator@2.0.0": | |
| 111, | |
| "url-validator@2.0.1": | |
| 49, | |
| "url-validator@2.1.0": | |
| 51, | |
| "uuid@1.0.0": | |
| 70, | |
| "uuid@1.0.1": | |
| 71, | |
| "uuid@1.0.2": | |
| 62, | |
| "uuid@1.0.3": | |
| 76, | |
| "uuid@2.0.0": | |
| 69, | |
| "uuid@2.0.1": | |
| 132, | |
| "uuid@3.0.0": | |
| 65, | |
| "uuid@4.0.0": | |
| 55, | |
| "uuid@5.0.0": | |
| 50, | |
| "uuid@5.1.0": | |
| 74, | |
| "uuid@5.2.0": | |
| 61, | |
| "uuid@5.2.1": | |
| 74, | |
| "uuid@5.2.2": | |
| 60, | |
| "uuid@6.0.0": | |
| 126, | |
| "uuid@6.0.1": | |
| 52, | |
| "uuid@6.1.0": | |
| 481, | |
| "uuid@7.0.0": | |
| 441, | |
| "uuid@8.0.0": | |
| 171, | |
| "uuid@9.0.0": | |
| 128, | |
| "uuidv4@1.0.0": | |
| 191, | |
| "validated-molecule@1.0.0": | |
| 74, | |
| "validated-molecule@1.0.1": | |
| 75, | |
| "validated-molecule@1.0.2": | |
| 79, | |
| "validated-molecule@1.0.3": | |
| 92, | |
| "validated-molecule@1.0.4": | |
| 84, | |
| "validated-molecule@1.0.5": | |
| 88, | |
| "validation@0.0.1": | |
| 140, | |
| "validation@0.0.2": | |
| 52, | |
| "validation@0.0.3": | |
| 52, | |
| "validation@0.1.0": | |
| 54, | |
| "validation@0.1.1": | |
| 71, | |
| "validation@0.2.0": | |
| 69, | |
| "validation@0.2.1": | |
| 64, | |
| "validation@1.0.0": | |
| 76, | |
| "validation@2.0.0": | |
| 132, | |
| "validation@3.0.0": | |
| 48, | |
| "validation@3.1.0": | |
| 59, | |
| "validation@3.2.0": | |
| 73, | |
| "validation@4.0.0": | |
| 81, | |
| "validation@4.1.0": | |
| 85, | |
| "validation@4.2.0": | |
| 121, | |
| "validation@5.0.0": | |
| 103, | |
| "validation@6.0.0": | |
| 52, | |
| "value-of-information@0.0.1": | |
| 256, | |
| "value-of-information@0.1.0": | |
| 212, | |
| "var@0.0.1": | |
| 68, | |
| "var@0.0.2": | |
| 69, | |
| "var@0.1.0": | |
| 68, | |
| "var@0.2.0": | |
| 62, | |
| "var@1.0.0": | |
| 156, | |
| "var@2.0.0": | |
| 98, | |
| "var@3.0.0": | |
| 56, | |
| "variant@1.0.0": | |
| 88, | |
| "variant@1.0.1": | |
| 83, | |
| "variant@1.1.0": | |
| 162, | |
| "variant@2.0.0": | |
| 187, | |
| "variant@2.1.0": | |
| 155, | |
| "variant@3.0.0": | |
| 160, | |
| "variant@3.1.0": | |
| 167, | |
| "variant@3.2.0": | |
| 166, | |
| "variant@3.2.1": | |
| 169, | |
| "variant@4.0.0": | |
| 254, | |
| "variant@4.1.0": | |
| 162, | |
| "variant@5.0.0": | |
| 82, | |
| "variant@5.1.0": | |
| 85, | |
| "variant@5.2.0": | |
| 97, | |
| "variant@6.0.0": | |
| 99, | |
| "variant@6.0.1": | |
| 103, | |
| "variant@7.0.0": | |
| 99, | |
| "variant@7.0.1": | |
| 204, | |
| "variant@7.0.2": | |
| 97, | |
| "variant@7.0.3": | |
| 76, | |
| "variant@7.1.0": | |
| 84, | |
| "variant@8.0.0": | |
| 86, | |
| "vary@0.1.0": | |
| 368, | |
| "vary@0.2.0": | |
| 694, | |
| "vary@1.0.0": | |
| 285, | |
| "vault@0.1.0": | |
| 158, | |
| "vdom@1.0.0": | |
| -213, | |
| "vdom@2.0.0": | |
| -348, | |
| "vdom@2.0.1": | |
| -355, | |
| "vdom@2.0.2": | |
| -359, | |
| "vector@1.0.0": | |
| 190, | |
| "vector@1.0.1": | |
| 200, | |
| "vector@1.0.3": | |
| 314, | |
| "vector@1.0.4": | |
| 178, | |
| "vector@1.0.5": | |
| 177, | |
| "vector@1.0.6": | |
| 190, | |
| "vector@1.0.7": | |
| 195, | |
| "vector@1.1.0": | |
| 233, | |
| "vector@1.2.0": | |
| 304, | |
| "vector@2.0.0": | |
| 443, | |
| "vector-space@0.0.1": | |
| 48, | |
| "vector-space@0.1.0": | |
| -67, | |
| "vectorfield@1.0.0": | |
| 110, | |
| "vectorfield@1.0.1": | |
| 120, | |
| "vectors@1.0.0": | |
| -300, | |
| "vectors@1.0.1": | |
| 298, | |
| "vectors@1.0.2": | |
| 417, | |
| "vectors@1.1.0": | |
| 285, | |
| "vega@0.0.1": | |
| 372, | |
| "vega@1.0.0": | |
| 236, | |
| "veither@1.0.0": | |
| 71, | |
| "veither@1.0.1": | |
| 178, | |
| "veither@1.0.2": | |
| 114, | |
| "veither@1.0.3": | |
| 255, | |
| "veither@1.0.4": | |
| 102, | |
| "veither@1.0.5": | |
| 161, | |
| "veither@1.0.6": | |
| 191, | |
| "verbal-expressions@0.2.1": | |
| 83, | |
| "verbal-expressions@1.0.0": | |
| 78, | |
| "verbal-expressions@1.0.1": | |
| 81, | |
| "verbal-expressions@2.0.0": | |
| -404, | |
| "verbal-expressions@3.0.0": | |
| 295, | |
| "verbal-expressions@4.0.0": | |
| 131, | |
| "versions@0.1.1": | |
| 65, | |
| "versions@2.0.0": | |
| 76, | |
| "versions@3.0.0": | |
| 196, | |
| "versions@3.0.1": | |
| 194, | |
| "versions@4.0.0": | |
| 253, | |
| "versions@5.0.0": | |
| 299, | |
| "versions@5.0.1": | |
| 160, | |
| "versions@6.0.0": | |
| 101, | |
| "versions@6.1.0": | |
| 100, | |
| "versions@7.0.0": | |
| 101, | |
| "vexceptt@1.0.0": | |
| 225, | |
| "vexceptt@1.0.1": | |
| 229, | |
| "vexceptt@1.0.2": | |
| 333, | |
| "vexceptt@2.0.0": | |
| 225, | |
| "vexflow@0.1.0": | |
| 139, | |
| "virtual-dom@0.1.0": | |
| 41, | |
| "virtual-dom@0.2.0": | |
| 74, | |
| "virtual-dom@0.3.0": | |
| 67, | |
| "virtual-dom-typed@0.0.2": | |
| -74, | |
| "virtual-dom-typed@0.1.0": | |
| -69, | |
| "virtual-dom-typed@0.1.1": | |
| 166, | |
| "virtual-dom-typed@0.1.2": | |
| 70, | |
| "visx@0.0.1": | |
| 133, | |
| "vnm-utility@0.0.1": | |
| 456, | |
| "vnm-utility@1.0.0": | |
| 377, | |
| "vnm-utility@2.0.0": | |
| 374, | |
| "vnm-utility@3.0.0": | |
| 120, | |
| "void@0.1.0": | |
| 62, | |
| "void@0.2.0": | |
| 157, | |
| "void@0.2.1": | |
| 88, | |
| "void@0.3.0": | |
| 61, | |
| "vom@0.1.0": | |
| -280, | |
| "vom@0.1.1": | |
| -241, | |
| "vom@0.1.2": | |
| -238, | |
| "vom@0.1.3": | |
| -239, | |
| "vom@0.1.4": | |
| -366, | |
| "vom@1.0.0": | |
| 538, | |
| "vom@1.1.0": | |
| 403, | |
| "vom@1.1.1": | |
| 395, | |
| "vom@1.1.2": | |
| 399, | |
| "vom@1.2.0": | |
| 508, | |
| "vom@1.3.0": | |
| 535, | |
| "vom@1.4.0": | |
| 694, | |
| "vom@1.5.0": | |
| 514, | |
| "vom@1.6.0": | |
| 506, | |
| "wamp@0.0.1": | |
| 305, | |
| "wamp@0.0.2": | |
| 315, | |
| "wamp@0.0.3": | |
| 314, | |
| "web-clipboard@1.0.0": | |
| 472, | |
| "web-clipboard@2.0.0": | |
| 624, | |
| "web-clipboard@3.0.0": | |
| 203, | |
| "web-clipboard@4.0.0": | |
| 141, | |
| "web-clipboard@4.1.0": | |
| 126, | |
| "web-clipboard@5.0.0": | |
| 131, | |
| "web-cssom@1.0.0": | |
| 228, | |
| "web-cssom@2.0.0": | |
| 173, | |
| "web-dom@1.0.0": | |
| 368, | |
| "web-dom@2.0.0": | |
| 263, | |
| "web-dom@3.0.0": | |
| 257, | |
| "web-dom@3.1.0": | |
| 270, | |
| "web-dom@4.0.0": | |
| 274, | |
| "web-dom@4.0.1": | |
| 274, | |
| "web-dom@4.0.2": | |
| 394, | |
| "web-dom@4.1.0": | |
| 268, | |
| "web-dom@5.0.0": | |
| 124, | |
| "web-dom@6.0.0": | |
| 113, | |
| "web-dom-parser@5.0.0": | |
| 296, | |
| "web-dom-parser@6.0.0": | |
| 297, | |
| "web-dom-parser@6.1.0": | |
| 388, | |
| "web-dom-parser@6.1.1": | |
| 292, | |
| "web-dom-parser@7.0.0": | |
| 139, | |
| "web-dom-parser@8.0.0": | |
| 111, | |
| "web-dom-xpath@1.0.0": | |
| 353, | |
| "web-dom-xpath@1.0.1": | |
| 258, | |
| "web-dom-xpath@1.0.2": | |
| 256, | |
| "web-dom-xpath@1.1.0": | |
| 274, | |
| "web-dom-xpath@1.2.0": | |
| 273, | |
| "web-dom-xpath@1.2.1": | |
| 366, | |
| "web-dom-xpath@1.2.2": | |
| 247, | |
| "web-dom-xpath@2.0.0": | |
| 150, | |
| "web-dom-xpath@2.0.1": | |
| 152, | |
| "web-dom-xpath@3.0.0": | |
| 135, | |
| "web-encoding@1.0.0": | |
| 66, | |
| "web-encoding@2.0.0": | |
| 72, | |
| "web-encoding@3.0.0": | |
| 60, | |
| "web-events@1.0.0": | |
| 249, | |
| "web-events@1.0.1": | |
| 148, | |
| "web-events@2.0.0": | |
| 144, | |
| "web-events@2.0.1": | |
| 142, | |
| "web-events@3.0.0": | |
| 109, | |
| "web-events@4.0.0": | |
| 100, | |
| "web-fetch@1.0.0": | |
| 228, | |
| "web-fetch@1.0.1": | |
| 231, | |
| "web-fetch@2.0.0": | |
| 249, | |
| "web-fetch@3.0.0": | |
| 110, | |
| "web-file@1.0.0": | |
| 257, | |
| "web-file@1.1.0": | |
| 255, | |
| "web-file@1.2.0": | |
| 261, | |
| "web-file@2.0.0": | |
| 260, | |
| "web-file@2.1.0": | |
| 265, | |
| "web-file@2.1.1": | |
| 268, | |
| "web-file@2.1.2": | |
| 373, | |
| "web-file@2.2.0": | |
| 247, | |
| "web-file@2.3.0": | |
| 248, | |
| "web-file@3.0.0": | |
| 131, | |
| "web-file@4.0.0": | |
| 114, | |
| "web-file-directory-entries@0.1.0": | |
| 318, | |
| "web-html@1.0.0": | |
| 523, | |
| "web-html@1.1.0": | |
| 371, | |
| "web-html@1.1.1": | |
| 366, | |
| "web-html@1.2.0": | |
| 373, | |
| "web-html@2.0.0": | |
| 379, | |
| "web-html@2.0.1": | |
| 383, | |
| "web-html@2.1.0": | |
| 383, | |
| "web-html@2.2.0": | |
| 494, | |
| "web-html@2.2.1": | |
| 383, | |
| "web-html@2.2.2": | |
| 370, | |
| "web-html@2.3.0": | |
| 370, | |
| "web-html@3.0.0": | |
| 178, | |
| "web-html@3.0.1": | |
| 177, | |
| "web-html@3.1.0": | |
| 178, | |
| "web-html@3.2.0": | |
| 179, | |
| "web-html@3.2.1": | |
| 286, | |
| "web-html@4.0.0": | |
| 131, | |
| "web-html@4.1.0": | |
| 127, | |
| "web-pointerevents@1.0.0": | |
| 133, | |
| "web-proletarian@0.1.0": | |
| 109, | |
| "web-proletarian@0.1.1": | |
| 62, | |
| "web-proletarian@1.0.0": | |
| 70, | |
| "web-promise@1.0.0": | |
| 163, | |
| "web-promise@1.0.1": | |
| 58, | |
| "web-promise@1.0.2": | |
| 60, | |
| "web-promise@1.0.3": | |
| 73, | |
| "web-promise@2.0.0": | |
| 83, | |
| "web-promise@2.0.1": | |
| 81, | |
| "web-promise@2.1.0": | |
| 176, | |
| "web-promise@3.0.0": | |
| 92, | |
| "web-promise@3.1.0": | |
| 61, | |
| "web-resize-observer@1.0.0": | |
| 111, | |
| "web-router@0.0.2": | |
| 298, | |
| "web-router@0.0.3": | |
| 299, | |
| "web-router@0.0.4": | |
| 298, | |
| "web-router@0.1.0": | |
| 300, | |
| "web-router@0.2.0": | |
| 398, | |
| "web-router@0.2.1": | |
| 280, | |
| "web-router@0.3.0": | |
| 160, | |
| "web-router@1.0.0": | |
| 114, | |
| "web-socket@1.0.0": | |
| 342, | |
| "web-socket@2.0.0": | |
| 344, | |
| "web-socket@3.0.0": | |
| 273, | |
| "web-socket@4.0.0": | |
| 127, | |
| "web-speech@0.1.0": | |
| 126, | |
| "web-speech@0.1.1": | |
| 124, | |
| "web-speech@0.2.0": | |
| 141, | |
| "web-storage@1.0.0": | |
| 63, | |
| "web-storage@2.0.0": | |
| 257, | |
| "web-storage@3.0.0": | |
| 252, | |
| "web-storage@4.0.0": | |
| 258, | |
| "web-storage@5.0.0": | |
| 106, | |
| "web-streams@1.0.0": | |
| 54, | |
| "web-streams@2.0.0": | |
| 65, | |
| "web-streams@3.0.0": | |
| 77, | |
| "web-touchevents@1.0.0": | |
| 1488, | |
| "web-touchevents@2.0.0": | |
| 1574, | |
| "web-touchevents@3.0.0": | |
| 584, | |
| "web-touchevents@4.0.0": | |
| 282, | |
| "web-uievents@1.0.0": | |
| 461, | |
| "web-uievents@1.1.0": | |
| 455, | |
| "web-uievents@2.0.0": | |
| 473, | |
| "web-uievents@3.0.0": | |
| 220, | |
| "web-uievents@4.0.0": | |
| 159, | |
| "web-url@1.0.1": | |
| 344, | |
| "web-url@1.0.2": | |
| 470, | |
| "web-url@2.0.0": | |
| 114, | |
| "web-urlsearchparams@0.0.0": | |
| 170, | |
| "web-urlsearchparams@0.0.1": | |
| 172, | |
| "web-workers@0.1.0": | |
| 63, | |
| "web-workers@0.1.1": | |
| 70, | |
| "web-workers@0.1.2": | |
| 68, | |
| "web-workers@0.2.0": | |
| 186, | |
| "web-workers@1.0.0": | |
| 95, | |
| "web-workers@1.1.0": | |
| 95, | |
| "web-xhr@1.0.0": | |
| 603, | |
| "web-xhr@1.1.0": | |
| 600, | |
| "web-xhr@2.0.0": | |
| 366, | |
| "web-xhr@3.0.0": | |
| 260, | |
| "web-xhr@3.0.1": | |
| 243, | |
| "web-xhr@3.0.2": | |
| 250, | |
| "web-xhr@4.0.0": | |
| 150, | |
| "web-xhr@4.1.0": | |
| 153, | |
| "web-xhr@5.0.0": | |
| 125, | |
| "web3@0.1.1": | |
| 852, | |
| "web3@0.9.0": | |
| 591, | |
| "web3@0.10.0": | |
| -412, | |
| "web3@0.11.0": | |
| -390, | |
| "web3@0.11.1": | |
| -405, | |
| "web3@0.11.2": | |
| -409, | |
| "web3@0.11.4": | |
| -513, | |
| "web3@0.12.0": | |
| -393, | |
| "web3@0.13.0": | |
| -399, | |
| "web3@0.14.0": | |
| -409, | |
| "web3@0.15.0": | |
| -422, | |
| "web3@0.15.2": | |
| 413, | |
| "web3@0.15.3": | |
| 407, | |
| "web3@0.16.0": | |
| 523, | |
| "web3@0.16.1": | |
| 385, | |
| "web3@0.17.0": | |
| 374, | |
| "web3@0.18.0": | |
| 385, | |
| "web3@0.18.1": | |
| 394, | |
| "web3@0.18.2": | |
| 398, | |
| "web3@0.18.3": | |
| 397, | |
| "web3@0.18.4": | |
| 510, | |
| "web3@0.19.0": | |
| -349, | |
| "web3@0.20.0": | |
| -344, | |
| "web3@0.21.0": | |
| -354, | |
| "web3@0.22.0": | |
| -378, | |
| "web3@0.22.1": | |
| -377, | |
| "web3@0.23.0": | |
| 538, | |
| "web3@0.23.1": | |
| 648, | |
| "web3@0.23.2": | |
| 513, | |
| "web3@0.23.3": | |
| 540, | |
| "web3@0.24.0": | |
| 558, | |
| "web3@0.25.0": | |
| 559, | |
| "web3@0.25.1": | |
| 566, | |
| "web3@1.0.0": | |
| 537, | |
| "web3-generator@0.1.0": | |
| -885, | |
| "web3-generator@0.9.0": | |
| 997, | |
| "web3-generator@0.10.0": | |
| -939, | |
| "web3-generator@0.11.0": | |
| -973, | |
| "web3-generator@0.12.0": | |
| -1103, | |
| "web3-generator@0.13.0": | |
| -969, | |
| "web3-generator@0.14.0": | |
| -951, | |
| "web3-generator@0.14.1": | |
| -974, | |
| "web3-generator@0.15.0": | |
| -986, | |
| "web3-generator@0.15.2": | |
| 958, | |
| "web3-generator@0.15.3": | |
| 1081, | |
| "web3-generator@0.16.0": | |
| 935, | |
| "web3-generator@0.16.1": | |
| 913, | |
| "web3-generator@0.17.0": | |
| 944, | |
| "web3-generator@0.17.1": | |
| 938, | |
| "web3-generator@0.17.2": | |
| 957, | |
| "web3-generator@0.18.0": | |
| 1081, | |
| "web3-generator@0.19.0": | |
| -877, | |
| "web3-generator@0.20.0": | |
| -869, | |
| "web3-generator@0.21.0": | |
| -803, | |
| "web3-generator@0.21.1": | |
| -815, | |
| "web3-generator@0.21.2": | |
| -820, | |
| "web3-generator@0.22.0": | |
| 1064, | |
| "web3-generator@0.23.0": | |
| 858, | |
| "web3-generator@0.24.0": | |
| 855, | |
| "web3-generator@3.0.0": | |
| -365, | |
| "web3-generator@4.0.0": | |
| -271, | |
| "webapp@0.0.0": | |
| -560, | |
| "webaudio@0.1.0": | |
| 278, | |
| "webaudio@0.1.1": | |
| 649, | |
| "webaudio@0.1.2": | |
| 608, | |
| "webaudio@0.2.0": | |
| 282, | |
| "webaudio@0.2.1": | |
| 296, | |
| "webcomponents@0.1.0": | |
| 511, | |
| "webdriver@0.1.0": | |
| 201, | |
| "webdriver@0.2.0": | |
| 93, | |
| "webdriver@0.2.1": | |
| 82, | |
| "webdriver@0.2.2": | |
| 77, | |
| "webdriver@0.2.3": | |
| 99, | |
| "webdriver@0.3.0": | |
| -98, | |
| "webdriver@0.3.1": | |
| -98, | |
| "webdriver@0.4.0": | |
| -106, | |
| "webdriver@0.5.0": | |
| -195, | |
| "webdriver@0.6.0": | |
| -89, | |
| "webdriver@0.6.1": | |
| -84, | |
| "webdriver@0.6.2": | |
| -86, | |
| "webdriver@0.7.0": | |
| 117, | |
| "webdriver@0.7.1": | |
| 120, | |
| "webdriver@0.7.2": | |
| 115, | |
| "webdriver@0.8.0": | |
| 118, | |
| "webdriver@0.9.0": | |
| 225, | |
| "webdriver@0.10.0": | |
| 110, | |
| "webdriver@0.11.0": | |
| 104, | |
| "webdriver@0.11.1": | |
| 104, | |
| "webdriver@0.11.2": | |
| 118, | |
| "webdriver@0.11.3": | |
| 123, | |
| "webdriver@0.11.4": | |
| 139, | |
| "webdriver@0.12.0": | |
| 110, | |
| "webdriver@0.13.0": | |
| 212, | |
| "webdriver@0.14.0": | |
| 102, | |
| "webdriver@0.14.1": | |
| 102, | |
| "webdriver@0.16.0": | |
| 96, | |
| "webdriver@0.17.0": | |
| 112, | |
| "webdriver@0.18.0": | |
| 113, | |
| "webdriver@0.19.0": | |
| 108, | |
| "webdriver@1.0.0": | |
| 82, | |
| "webdriver@2.0.0": | |
| -302, | |
| "webdriver@3.0.0": | |
| 551, | |
| "webdriver@3.0.1": | |
| 525, | |
| "webdriver@4.0.0": | |
| 725, | |
| "webdriver@4.0.1": | |
| 709, | |
| "webdriver@5.0.0": | |
| 720, | |
| "webdriver@5.0.1": | |
| 724, | |
| "webdriver@6.0.0": | |
| 596, | |
| "weber@0.1.1": | |
| 40, | |
| "weber@0.1.2": | |
| 56, | |
| "weber@0.1.3": | |
| 57, | |
| "weber@0.1.4": | |
| 70, | |
| "webgl@1.1.0": | |
| 308, | |
| "webgl@1.1.1": | |
| 301, | |
| "webgl@1.1.2": | |
| 299, | |
| "webgl@1.1.3": | |
| 408, | |
| "webgl@1.2.0": | |
| -267, | |
| "webgl@1.3.0": | |
| 244, | |
| "webgl@1.3.1": | |
| 259, | |
| "webgl@1.3.2": | |
| 262, | |
| "webgl@2.0.0": | |
| -799, | |
| "webgl@2.0.1": | |
| 530, | |
| "webgl-examples@1.0.1": | |
| 457, | |
| "webgl-examples@1.0.2": | |
| 469, | |
| "webgl-examples@1.1.0": | |
| -375, | |
| "webgl-examples@1.2.0": | |
| -237, | |
| "webgl-examples@1.3.0": | |
| 405, | |
| "webgl2-raw@1.0.0": | |
| 376, | |
| "webidl@0.1.0": | |
| 154, | |
| "webidl@0.2.0": | |
| 78, | |
| "webidl@1.0.0": | |
| 59, | |
| "webidl@1.0.1": | |
| 71, | |
| "webidl@2.0.0": | |
| 288, | |
| "webidl@3.0.0": | |
| 257, | |
| "websocket-moderate@0.0.0": | |
| 146, | |
| "websocket-moderate@0.0.1": | |
| 52, | |
| "websocket-moderate@1.0.0": | |
| 65, | |
| "websocket-moderate@1.0.1": | |
| 84, | |
| "websocket-moderate@2.0.0": | |
| 268, | |
| "websocket-moderate@2.0.1": | |
| 416, | |
| "websocket-moderate@3.0.0": | |
| 460, | |
| "websocket-moderate@3.1.0": | |
| 309, | |
| "websocket-moderate@4.0.0": | |
| 372, | |
| "websocket-moderate@5.0.0": | |
| 582, | |
| "websocket-moderate@6.0.0": | |
| 604, | |
| "websocket-moderate@7.0.0": | |
| 564, | |
| "websocket-moderate@7.0.1": | |
| 625, | |
| "websocket-moderate@7.0.2": | |
| 675, | |
| "websocket-moderate-extra@0.0.0": | |
| 725, | |
| "websocket-moderate-extra@0.0.1": | |
| 755, | |
| "websocket-simple@0.0.1": | |
| 99, | |
| "websocket-simple@0.1.0": | |
| 100, | |
| "websocket-simple@0.2.0": | |
| 200, | |
| "websocket-simple@0.3.0": | |
| 95, | |
| "websocket-simple@0.4.0": | |
| 60, | |
| "websocket-simple@0.5.0": | |
| -179, | |
| "websocket-simple@0.5.1": | |
| -197, | |
| "websocket-simple@1.0.0": | |
| 424, | |
| "websocket-simple@1.0.1": | |
| 414, | |
| "websocket-simple@2.0.0": | |
| 637, | |
| "websocket-simple@3.0.0": | |
| 418, | |
| "websocket-simple@3.0.1": | |
| 272, | |
| "websockets-rpc@1.0.3": | |
| -499, | |
| "websockets-rpc@1.0.4": | |
| -508, | |
| "websockets-rpc@1.0.5": | |
| -517, | |
| "websockets-rpc@1.1.0": | |
| -625, | |
| "websockets-rpc@1.2.0": | |
| -363, | |
| "websockets-rpc@1.3.0": | |
| -349, | |
| "websockets-rpc@1.3.1": | |
| -349, | |
| "websockets-rpc@1.4.0": | |
| -396, | |
| "websockets-rpc@1.4.1": | |
| -392, | |
| "webstorage@0.0.1": | |
| 65, | |
| "webstorage@0.1.0": | |
| 69, | |
| "webstorage@0.2.0": | |
| 112, | |
| "webstorage@0.3.0": | |
| 48, | |
| "webstorage@0.4.0": | |
| 66, | |
| "webstorage@1.0.0": | |
| 51, | |
| "webstorage@2.0.0": | |
| 87, | |
| "webstorage@3.0.0": | |
| 72, | |
| "webstorage@3.0.1": | |
| 148, | |
| "webstorage@3.0.2": | |
| 105, | |
| "webstorage@3.0.3": | |
| 49, | |
| "webstorage@3.0.4": | |
| 66, | |
| "webstorage@4.0.0": | |
| 68, | |
| "webworkers@0.1.1": | |
| 308, | |
| "webworkers@0.1.2": | |
| 281, | |
| "webworkers@0.2.0": | |
| 271, | |
| "wechaty@1.0.0": | |
| 703, | |
| "wechaty@1.0.1": | |
| 553, | |
| "which@0.1.0": | |
| 66, | |
| "which@1.0.0": | |
| 104, | |
| "which@2.0.0": | |
| 105, | |
| "wikitext@0.0.2": | |
| 78, | |
| "wikitext@0.0.3": | |
| 80, | |
| "wikitext@0.0.4": | |
| 79, | |
| "wikitext@0.0.5": | |
| 192, | |
| "wikitext@0.0.6": | |
| 82, | |
| "winston@0.1.0": | |
| 50, | |
| "wire@0.1.0": | |
| 105, | |
| "wire@0.1.1": | |
| 105, | |
| "wire@0.1.2": | |
| 101, | |
| "wire@0.1.3": | |
| 102, | |
| "wire@0.1.4": | |
| 105, | |
| "wire@0.2.0": | |
| 263, | |
| "wire@0.2.1": | |
| 137, | |
| "wire@0.2.2": | |
| 134, | |
| "wire@0.2.3": | |
| 149, | |
| "wire@0.2.4": | |
| 148, | |
| "wire@0.2.5": | |
| 256, | |
| "wire@0.3.0": | |
| 215, | |
| "wire@0.3.1": | |
| 212, | |
| "wire@0.3.2": | |
| 209, | |
| "wire@0.3.3": | |
| 220, | |
| "wire@0.3.4": | |
| 222, | |
| "wire@0.3.5": | |
| 347, | |
| "wire@0.3.6": | |
| 218, | |
| "wire@0.3.7": | |
| 207, | |
| "wire@0.4.0": | |
| 411, | |
| "wire@0.4.1": | |
| 424, | |
| "wire@0.4.2": | |
| 217, | |
| "wire@0.5.0": | |
| 272, | |
| "with-index@1.0.0": | |
| 62, | |
| "with-index@1.0.1": | |
| 162, | |
| "with-index@2.0.0": | |
| 48, | |
| "wkhtmltopdf@1.0.0": | |
| 131, | |
| "wkhtmltopdf@1.0.1": | |
| 100, | |
| "word@0.1.0": | |
| 837, | |
| "word@0.2.0": | |
| 815, | |
| "word@0.3.0": | |
| 957, | |
| "word@0.4.0": | |
| 799, | |
| "word@0.4.1": | |
| 792, | |
| "words-lines@0.0.1": | |
| 59, | |
| "words-lines@0.0.2": | |
| 85, | |
| "words-lines@0.0.3": | |
| 78, | |
| "words-lines@0.0.4": | |
| 80, | |
| "words-lines@0.0.5": | |
| 173, | |
| "workers@1.0.0": | |
| 327, | |
| "workers@2.0.0": | |
| 441, | |
| "workers@2.1.0": | |
| 737, | |
| "workly@0.1.0": | |
| 118, | |
| "workly@0.1.1": | |
| 123, | |
| "wrappable@1.0.0": | |
| 56, | |
| "ws@0.0.1": | |
| 644, | |
| "ws@0.0.2": | |
| 743, | |
| "xhr@0.4.0": | |
| 48, | |
| "xiaomian@0.1.0": | |
| 95, | |
| "xorshift@0.0.1": | |
| 60, | |
| "xorshift@1.0.0": | |
| 89, | |
| "xorshift@2.0.0": | |
| 73, | |
| "xorshift@3.0.0": | |
| 156, | |
| "xorshift@3.0.1": | |
| 90, | |
| "xpath@0.1.0": | |
| 174, | |
| "xpath-like@1.0.0": | |
| 41, | |
| "xpath-like@1.0.1": | |
| 65, | |
| "xpath-like@2.0.0": | |
| 71, | |
| "xpath-like@3.0.0": | |
| 67, | |
| "xstream@0.1.0": | |
| 78, | |
| "xstream@0.1.1": | |
| 164, | |
| "xstream@0.1.2": | |
| 78, | |
| "xstream@0.2.0": | |
| 61, | |
| "xstream@0.2.1": | |
| 68, | |
| "xstream@0.3.0": | |
| 68, | |
| "xstream@0.4.0": | |
| 88, | |
| "xstream@0.4.1": | |
| 78, | |
| "xstream@0.4.2": | |
| 96, | |
| "xstream@0.5.0": | |
| 487, | |
| "xstream@0.6.0": | |
| 324, | |
| "xstream@0.6.1": | |
| 297, | |
| "xstream@0.7.0": | |
| 361, | |
| "xstream@0.8.0": | |
| 321, | |
| "xstream@0.9.0": | |
| 606, | |
| "xstream@0.9.1": | |
| 557, | |
| "xstream@1.0.0": | |
| 685, | |
| "yaml-next@0.1.0": | |
| 366, | |
| "yaml-next@0.2.0": | |
| 414, | |
| "yaml-next@1.0.0": | |
| 184, | |
| "yaml-next@2.0.0": | |
| 398, | |
| "yaml-next@3.0.0": | |
| 174, | |
| "yaml-next@3.0.1": | |
| 221, | |
| "yargs@0.2.1": | |
| -39, | |
| "yargs@0.3.0": | |
| -56, | |
| "yargs@0.4.0": | |
| 74, | |
| "yargs@0.5.0": | |
| 74, | |
| "yargs@0.7.2": | |
| 185, | |
| "yargs@0.7.3": | |
| 73, | |
| "yargs@1.0.0": | |
| 53, | |
| "yargs@1.0.1": | |
| 58, | |
| "yargs@2.0.0": | |
| 226, | |
| "yargs@3.0.0": | |
| 191, | |
| "yargs@3.0.1": | |
| 290, | |
| "yargs@3.1.0": | |
| 252, | |
| "yargs@4.0.0": | |
| 381, | |
| "yarn@1.1.0": | |
| 50, | |
| "yarn@1.2.0": | |
| 60, | |
| "yarn@1.3.0": | |
| 56, | |
| "yarn@1.3.1": | |
| 74, | |
| "yarn@2.0.0": | |
| 173, | |
| "yarn@3.0.0": | |
| 162, | |
| "yarn@3.0.1": | |
| 160, | |
| "yarn@4.0.0": | |
| 287, | |
| "yayamll@0.0.1": | |
| 372, | |
| "yayamll@0.0.2": | |
| 353, | |
| "yayamll@1.0.0": | |
| 356, | |
| "yayamll@1.1.0": | |
| 167, | |
| "yayamll@1.1.1": | |
| 182, | |
| "yesod-auth@0.1.0": | |
| -166, | |
| "yoga-fetch@1.0.1": | |
| 234, | |
| "yoga-json@1.0.0": | |
| 85, | |
| "yoga-json@1.0.1": | |
| 83, | |
| "yoga-json@2.0.0": | |
| 87, | |
| "yoga-json@3.0.0": | |
| 121, | |
| "yoga-json@3.0.1": | |
| 113, | |
| "yoga-json@3.0.2": | |
| 111, | |
| "yoga-json@4.0.0": | |
| 261, | |
| "yoga-json@4.0.1": | |
| 108, | |
| "yoga-om@0.1.0": | |
| 86, | |
| "yoga-postgres@0.1.0": | |
| 64, | |
| "yoga-postgres@0.2.0": | |
| 102, | |
| "yoga-postgres@0.2.1": | |
| 98, | |
| "yoga-postgres@0.2.2": | |
| 97, | |
| "yoga-postgres@1.0.0": | |
| 80, | |
| "yoga-postgres@2.0.0": | |
| 388, | |
| "yoga-postgres@3.0.0": | |
| 346, | |
| "yoga-postgres@4.0.0": | |
| 281, | |
| "yoga-postgres@4.1.0": | |
| 291, | |
| "yoga-postgres@5.0.0": | |
| 227, | |
| "yoga-postgres@6.0.0": | |
| 108, | |
| "yoga-tree@1.0.0": | |
| 81, | |
| "z85@0.0.0": | |
| 353, | |
| "z85@0.0.1": | |
| 243, | |
| "z85@0.0.2": | |
| -456, | |
| "zclipboard@0.1.0": | |
| 629, | |
| "zclipboard@0.3.0": | |
| 108, | |
| "zclipboard@1.0.0": | |
| 171, | |
| "zclipboard@1.0.1": | |
| 78, | |
| "zclipboard@2.0.0": | |
| -210, | |
| "zclipboard@3.0.0": | |
| 483, | |
| "zeromq@0.0.0": | |
| 579, | |
| "zeromq@0.0.1": | |
| 394, | |
| "zeromq@0.0.2": | |
| 797, | |
| "zeromq@0.0.3": | |
| 930, | |
| "zeromq@0.0.4": | |
| 783, | |
| "zeromq@0.0.5": | |
| 350, | |
| "zeromq@0.0.6": | |
| 433, | |
| "zeromq@0.0.7": | |
| 444, | |
| "zeta@0.0.0": | |
| 399, | |
| "zeta@0.0.1": | |
| 399, | |
| "zeta@0.0.2": | |
| 516, | |
| "zeta@0.0.3": | |
| 389, | |
| "zeta@0.0.4": | |
| 373, | |
| "zeta@0.0.5": | |
| 380, | |
| "zeta@0.0.6": | |
| 403, | |
| "zeta@1.0.0": | |
| 397, | |
| "zeta@1.1.0": | |
| 453, | |
| "zeta@1.2.0": | |
| 569, | |
| "zeta@1.2.1": | |
| 443, | |
| "zeta@1.3.0": | |
| 430, | |
| "zeta@2.0.0": | |
| 440, | |
| "zeta@3.0.0": | |
| 311, | |
| "zeta@3.0.1": | |
| 308, | |
| "zeta@4.0.0": | |
| 310, | |
| "zeta@5.0.0": | |
| 338, | |
| "zeta@5.0.1": | |
| 209, | |
| "zeta@5.0.2": | |
| 174, | |
| "zeta@5.0.3": | |
| 168, | |
| "zeta@5.0.4": | |
| 184, | |
| "zeta@6.0.0": | |
| 188, | |
| "zeta-extra@0.0.0": | |
| 457, | |
| "zeta-extra@0.0.1": | |
| 395, | |
| "zippable@0.1.0": | |
| 276, | |
| "zipperarray@1.0.0": | |
| 75, | |
| "zipperarray@1.0.1": | |
| 78, | |
| "zipperarray@1.1.0": | |
| 157, | |
| "zmq@0.0.1": | |
| -192, | |
| } |
Sign up for free
to join this conversation on GitHub.
Already have an account?
Sign in to comment